Conserved Protein Domain Family
PHA02651

?
PHA02651: PHA02651 
IL-1 receptor antagonist; Provisional
Statistics
?
PSSM-Id: 165031
View PSSM: PHA02651
Aligned: 2 rows
Threshold Bit Score: 277.683
Threshold Setting Gi: 211956325
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637431    1 MKKLILLLVLYINIFNSKAAgMFMYSIWDVNQKIFYLRNNQLVAGNIQDNSLAEKITVKLNDGNSMFLGVKNGEKSLECT 80 
211956325   1 MKKLILLLVLYINIFNSRAA-MLTYNIWDVNQKIFYLRNNQLVAGHIQDNSLAEKITAKLIGGNDIFLGVKNGEKSLECT 79 
62637431   81 KHGDKVTLSLSDKKTNSLDENQDKRFAFIRSDNGLTSTFESVAFPGWFLCTSSGDGIEPVGLTYKGDKDDnDDDKNNIYF 160
211956325  80 EHGDKVTLSLSDKKTNSLDESQDKRFAFIRSDNGHTSTFESVAFPGWFLCTSSGDGIEPVGLTYKGDKDD-DNDENNIYF 158
62637431  161 YFEED 165
211956325 159 YFEEE 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap