Conserved Protein Domain Family
PHA02650

?
PHA02650: PHA02650 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165030
View PSSM: PHA02650
Aligned: 2 rows
Threshold Bit Score: 109.682
Threshold Setting Gi: 211956323
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637429   1 MDKLYAAIFGVFMSSTDDDFNNFIDVVKSVLSDEDGSKKtTKSVSWFNSQNFLFLIFSLIIVSLFSFFVFKGYTRNLNGR 80 
211956323  1 MDKLYAAIFGVFMSSTDDDFNNFIDVVKSVLSDEDSSKK-IKSVSWFNGQNFIFLIFSLIIVALFSFFVFKGYTRNLNGR 79 
62637429  81 K 81 
211956323 80 K 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap