Conserved Protein Domain Family
PHA02649

?
PHA02649: PHA02649 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165029
View PSSM: PHA02649
Aligned: 2 rows
Threshold Bit Score: 135.056
Threshold Setting Gi: 62637447
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637447   1 MAEVLINKLRNIELDNYGNEKIIDCIIYEIENTQYVIVRPILRLIVDLMILLIVLNDVIIRVIKRNYKILLISSFCVSML 80 
211956341  1 MAEVLINKLRNIELDNYGNEKIIDCIIYEIENTQYVIVRPILRLIVDLMILLIVLNDVIIRVIKRNYKILLISSFCVSML 80 
62637447  81 YFLIHKEENLNDNGS 95 
211956341 81 YFLIHKEENLNDNGS 95 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap