Conserved Protein Domain Family
PHA02646

?
PHA02646: PHA02646 
virion protein; Provisional
Statistics
?
PSSM-Id: 165027
View PSSM: PHA02646
Aligned: 2 rows
Threshold Bit Score: 253.009
Threshold Setting Gi: 211956360
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637467    1 MMNLEEIKKITNIIHQFNIVCNVDIEKIYSSETIVLEMSLDGTINAIHIYDNIVSRFDNKTMLGIAKFIYRNSEWILKLL 80 
211956360   1 MMNLEEIKKITNIIHQFNIVCNVDIEKIYSSETIVLEMSLDGTINAIHIYDNIVSRFDNKTMLGIAKFIYRNSEWILKLL 80 
62637467   81 FINDDIEKIINPIYPSKTITINSKPKLDEIMPSNIISLKTVLLNLFNSFKYGELCKKSLPYYYSPFRKDIYDIILK 156
211956360  81 FINDDIEKIINPIYPSKTITINSKPKLDEIMPSNIISLKIVLLNLFNSFKYGELCKKSLPYYYSPFRKDIYDIILK 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap