Conserved Protein Domain Family
PHA02644

?
PHA02644: PHA02644 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165026
View PSSM: PHA02644
Aligned: 2 rows
Threshold Bit Score: 105.85
Threshold Setting Gi: 62637517
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956411   1 MLESYNTYAKVNINVSTKDQVIKIMIGSSPYMDVRIVSNKYDKIFISNEDEMKTTHEHTKKENEDEKKPEKPENEDEKKP 80 
62637517    1 MLESYNTYAKVNINVSTKDQVIKIMIGSSPYMDVRIVSNKYDKLFISNEDEMKTTHEHIKKENEDEKKSEKPENEDEKKS 80 
211956411  81 EKPENEDEKKpekpenedekeFEDSDASDKKK 112
62637517   81 EKPENEDEKK-----------FEDSDSSDKNL 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap