Conserved Protein Domain Family
PHA02643

?
PHA02643: PHA02643 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165025
View PSSM: PHA02643
Aligned: 2 rows
Threshold Bit Score: 89.5384
Threshold Setting Gi: 62637518
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637518   1 MEEYDNIAIKITSENGSTISVCCESKSKITIDIVTKKNQSVSTKSIIKKKKLENTKKDDEYNYNTDTEESENAMEIDCIK 80 
211956412  1 MEEYDNIAIKITSENGSTISVCCESKSKITIDIVTKKNQSVSTKSIIKKKKLENTKKDEEYNYNTDTEESENAMEIDCIK 80 
62637518  81 NS 82 
211956412 81 NS 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap