Conserved Protein Domain Family
PHA02642

?
PHA02642: PHA02642 
C-type lectin-like protein; Provisional
Statistics
?
PSSM-Id: 165024
View PSSM: PHA02642
Aligned: 2 rows
Threshold Bit Score: 414.128
Threshold Setting Gi: 62637521
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956415   1 MFPELKMALKPTTTIVEMGKDDCCDTNSDKETETQKNYGQFTSFVTPEKLYCCIITICILITINLVPIIILMAFKSDTQE 80 
62637521    1 MFPELKMALKPTTEIVEMGKDDCRDTNSDKETETQKNYVQFTSFVTPEKLYCCIITICILITINLVPIIILMAFKSDTQE 80 
211956415  81 PTIKYVTCPKGWIGFGYKCFYFSEDSKNWTFGNTFCTSLGATLVKVETEEELNFLKRYKDSSDHWIGLNRESSNHPWKWS 160
62637521   81 PTIKYVTCPKGWIGFGYKCFYFSEDSKNWTFGNTFCTSLGATLVKVETEEELNFLKRYKDSSDHWIGLNRESSNHPWKWA 160
211956415 161 DNSSYNASFVITGTGECAYLNDIRISSSRVYANRKWICSKTYTNIYIPSNSSYNYP 216
62637521  161 DNSNYNSSFVITGTGECAYLNDIRISSSRVYANRKWICSKTYTNIYIPSNNSYNYP 216
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap