Conserved Protein Domain Family
PHA02641

?
PHA02641: PHA02641 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165023
View PSSM: PHA02641
Aligned: 2 rows
Threshold Bit Score: 306.162
Threshold Setting Gi: 211956419
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637525    1 MSDLTKVSTFEERNISFRMKNTEAGKDSTMMDDLMNDLMNDFSLMFLYDTADKINDHDSLENVLEDYFAWRAHISKIDIL 80 
211956419   1 MSDLTKVSTFEERNISFRMKNTETGKESTMMSDLMSDLMNDFSLMFLYDTADKINEHDSLENVLEDYFAWRAHISKIDIL 80 
62637525   81 PKNVGKLYLDLMDLDTFAKKMMGDLDILILDVLKLDEQDADVRLFNFISSTDINFNNCDTCLILIGFIGYVCSFWGKNNL 160
211956419  81 PKNVGKLYLDLMDLDTFAKKMMGDLDILILDVLKLDEQDADVRLFNFISSMDINFNNCDTCLILIGFIGYVCSFWGKHNL 160
62637525  161 ISEYLHSVMRGFLTHVNVETLENVKKYF 188
211956419 161 ISEYLHSVMRGFLTHVNLETLENVKKYF 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap