Conserved Protein Domain Family
PHA02639

?
PHA02639: PHA02639 
EEV host range protein; Provisional
Statistics
?
PSSM-Id: 165022
View PSSM: PHA02639
Aligned: 2 rows
Threshold Bit Score: 568.911
Threshold Setting Gi: 62637533
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956427   1 MKIILYLFIGVCYVHGVKSMYCDKPDDISNGFITELMEKYEIGKLIEYTCNTDYALIGDRFRTCIKDKNNAVWSNKAPFC 80 
62637533    1 MKIILYLFIGVCYVHGVKSIYCDKPDDISNGFITELMEKYEVGKLIEYTCNTGYALIGDRFRTCVKDKNNAIWSNKAPFC 80 
211956427  81 MLKECNDPPSIINGKIYNKREMYKVGDEIYYVCNEHKGVQYSLVGNEKITCTQDKSWKPDPPICKMINCRFPALQNGYIN 160
62637533   81 MLKECNDPPSIINGKIYNKREMYKVGDEIYYVCNEHRGVQYSLVGNEKITCIQDKSWKPDPPICKMINCRFPALQNGYIN 160
211956427 161 GIPSNKKFYYKTRVGFSCKSGFDLVGEKYSTCNINATWFPSIPTCVRNKPIDDIIYLKPVDDNFDDLDNEDKINTILHNN 240
62637533  161 GIPSNKKFYYKTRVGFSCKSGFDLVGEKYSTCNINATWFPSIPTCVRNKPIDDIIYLKPVDDNFDDLDNEDKINTILHNN 240
211956427 241 DANSTRINQEKENGNIFTVIILLSIISFMFILGVLSLLCSCMLKSSSKTSVYNKL 295
62637533  241 DANSTRINQEKENGNIFTVIILLSIISFMFILGVLSLLCSCMLKSSSKTSVYNKL 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap