Conserved Protein Domain Family
PHA02638

?
PHA02638: PHA02638 
CC chemokine receptor-like protein; Provisional
Statistics
?
PSSM-Id: 165021
View PSSM: PHA02638
Aligned: 2 rows
Threshold Bit Score: 485.287
Threshold Setting Gi: 62637539
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62637539    1 MDNSSTTLSSTTLSSTTLSSTTLSTietsMDESTSIISTITTIIPTIIPTSQSSSSSSSsssssssssssiTYDYeYYNN 80 
211956433   5 NNSSSTTMSSIITSSSVVSPTTFFT----SGYSKTITSTFTELITTETPTTETPTPNSN------------TYDY-YEYN 67 
62637539   81 ITYELINIKNMCMYPSITEYIRIFYIIIFILGLFGNAMIIMILFHKKIKTITDIYIFNLAISDLIFVIDFPFIIYNEFDQ 160
211956433  68 ITYELINIKNKCMYPSISEYVKVFYIILFILGLLGNVAVVTILFCKKIKTITDIYIFNLAMSDMIFVVDFPFIIYNEFDQ 147
62637539  161 WIFGDFMCKVISVSYYIGFFSNMFLITLMSIDRYFAILYPISFQKYRTFNIGLILCIITWSLSLLITSPTYFIFESSNMI 240
211956433 148 WIFGDFMCKVISASYYIGFFSNMFLITLMSIDRYFAILYPISFQKYRTFNIGITLTISSWILVLIITVPAYFMFEASNIV 227
62637539  241 YSKQDSNETISNYQCTVIEERENTNISFLKRMLQFEINILGMLIPIIIFAFCYIKIILKLKQLKKS-KTKSIRIVSIIIV 319
211956433 228 FTAQNSNETISNYQCTLIMDNQKNNMVLLGRILQFEINILGMFIPIIIFVFCYLKIILKLKQLKKSkKTKSIIIVSVIVI 307
62637539  320 CSLICWIPLNIVILIATVYSMQSFNSIISENICNFIKVGYAMMLTEAISLTHCCINPLIYTLIGENFRMHLLMIFRNLFt 399
211956433 308 CSLICWMPLNVVTLFATMYSFKGFSSIISEHICGVVKLGYAMMLAEAVSLTHCCINPLIYTLIGENFRMHLLMMFRRIH- 386
62637539  400 NTKFSFRKSSIsSSIIF 416
211956433 387 NARFSFRKSSV-SSLIF 402
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap