Conserved Protein Domain Family
PHA02636

?
PHA02636: PHA02636 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165019
View PSSM: PHA02636
Aligned: 2 rows
Threshold Bit Score: 45.7897
Threshold Setting Gi: 113195389
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195389  1 MSTFIIIDQSTENTSIYTTVTINIIHLAIMKIIMNiiIIMMIMIELV 47 
66275998  12 MSTFIIIDQSTENTSIDTTVTINIIYLAIMKIIMN--IIMMIMIELV 56 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap