Conserved Protein Domain Family
PHA02634

?
PHA02634: PHA02634 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165017
Aligned: 2 rows
Threshold Bit Score: 81.356
Threshold Setting Gi: 9627699
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627699    49 MEQLGITLGSDLEAYFMCKLQELNCDASILLNKASKNVMDRQLSKTPTR 97 
113195370   1 MEQLGITPGSDSEAYFMCRVTGSNCDLSILLNKASKNVMDRQLSKTPTR 49 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap