Conserved Protein Domain Family
PHA02633

?
PHA02633: PHA02633 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165016
View PSSM: PHA02633
Aligned: 2 rows
Threshold Bit Score: 99.6701
Threshold Setting Gi: 9627704
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627704   1 MGKREADNDRIIPIDNCNNMLILNPTQSDSGIYMCITKNETYSDMMSLNLTIVSVSESNIDLI 63 
18640427  1 MGKRGADNDRIILIDNGNNMLILNQTQSDSGIYMCITKNETYYDVVKFDNCVCLRIKYRSYFV 63 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap