Conserved Protein Domain Family
PHA02627

?
PHA02627: PHA02627 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177442
View PSSM: PHA02627
Aligned: 3 rows
Threshold Bit Score: 67.0126
Threshold Setting Gi: 113195231
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627559    1 MKHKVYSEGLEISTDFNSIISQLSTSDMDIEIDEDNITELLNILTELGCDVDFDEDFSDITDDVLESLMEQDM 73 
18640283   1 MKHRVYSEGLGISTDFNSIISQLSISDMDIEIDEDDIMELLNILTELGCDVDFDEDFSDIADDVLESLMEQDM 73 
113195231  1 MKHRVYSEGLGISQ--LSTSTSTSTSDMDIEIDEDDITELINILTELGCDVDFDEDFSDIADDVLESLMEQDM 71 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap