Conserved Protein Domain Family
PHA02621

?
PHA02621: PHA02621 
agnoprotein; Provisional
Statistics
?
PSSM-Id: 177440
View PSSM: PHA02621
Aligned: 5 rows
Threshold Bit Score: 69.1852
Threshold Setting Gi: 297591899
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224460771  1 MVLRQLSRQASVKVGKTWTGTKRRAQRIFIFILELLLDFCRGEDSVDGKKKKDSLTDKTETVTEKKES 68 
9628643    1 MVLRQLSRKASVKVSKTWSGTKKRAQRILIFLLEFLLDFCTGEDSVDGKKRQRHSGLTEQTYSALPEP 68 
113204631  1 MVLRQLSRQASVKVGKTWTGTKKRAQRIFIFILELLLEFCRGEDSVDGKNKSTTALPAVKDSVKDS-- 66 
82524375   1 MVLRQLSRQASVKVGKTWTGTKRRAQRIFIFILELLLDFCRGEDSVDGKKKKDSLTDKTETVTEKKES 68 
297591899  1 MVLRRLSRQASVKVRRSWTESKKTAQRLFVFVLELLLQFCEGEDTVDGKRKKP------ERLTEKPES 62 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap