Conserved Protein Domain Family
PHA02620

?
PHA02620: PHA02620 
VP3; Provisional
Statistics
?
PSSM-Id: 177439
View PSSM: PHA02620
Aligned: 10 rows
Threshold Bit Score: 471.031
Threshold Setting Gi: 9628645
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82524377  119 MALELFNPED-YDILFPGVNTFVNNIQYLDPRHWGPTLFSAISQAFWHLVRDDLPRLTSQEIERRTQRFFRDSLAKFLEE 197
82524378    1 MALELFNPED-YDILFPGVNTFVNNIQYLDPRHWGPTLFSAISQAFWHLVRDDLPRLTSQEIERRTQRFFRDSLAKFLEE 79 
113204632 120 MALELFNPDEyYDILFPGVNTFVNNIQYLDPRHWGPSLFATISQALWHVIRDDIPSITSQELQRRTERFFRDSLARFLEE 199
113204633   1 MALELFNPDEyYDILFPGVNTFVNNIQYLDPRHWGPSLFATISQALWHVIRDDIPSITSQELQRRTERFFRDSLARFLEE 80 
9628644   120 MALQLFNPEDyYDILFPGVNAFVNNIHYLDPRHWGPSLFSTISQAFWNLVRDDLPALTSQEIQRRTQKLFVESLARFLEE 199
9628645     1 MALQLFNPEDyYDILFPGVNAFVNNIHYLDPRHWGPSLFSTISQAFWNLVRDDLPALTSQEIQRRTQKLFVESLARFLEE 80 
224460772 119 MALELFNPED-YDILFPGVNTFVNNIQYLDPRHWGPTLFSAISQAFWHLVRDDLPRLTSQEIERRTQRFFRDSLAKFLEE 197
224460773   1 MALELFNPED-YDILFPGVNTFVNNIQYLDPRHWGPTLFSAISQAFWHLVRDDLPRLTSQEIERRTQRFFRDSLAKFLEE 79 
297591900 119 MAVDLYRPDDyYDILFPGVQTFVHSVQYLDPRHWGPTLFNAISQAFWRVIQNDIPRLTSQELERRTQRYLRDSLARFLEE 198
297591901   1 MAVDLYRPDDyYDILFPGVQTFVHSVQYLDPRHWGPTLFNAISQAFWRVIQNDIPRLTSQELERRTQRYLRDSLARFLEE 80 
82524377  198 TTWTIVNAPINLYNSIQNYYSALSPIRPSMVRQVAEREGTQVTFGHSYSQSIDDADSIEEVTQRLDLRNKEANVHSGEFI 277
82524378   80 TTWTIVNAPINLYNSIQNYYSALSPIRPSMVRQVAEREGTQVTFGHSYSQSIDDADSIEEVTQRLDLRNKEANVHSGEFI 159
113204632 200 TTWTIVNAPINFYNYIQQYYSDLSPIRPSMVRQVAEREGTRVHFGHTY--SIDDADSIEEVTQRMDLRNQQ-SVHSGEFI 276
113204633  81 TTWTIVNAPINFYNYIQQYYSDLSPIRPSMVRQVAEREGTRVHFGHTY--SIDDADSIEEVTQRMDLRNQQ-SVHSGEFI 157
9628644   200 TTWAIVNSPANLYNYISDYYSRLSPVRPSMVRQVAQREGTYISFGHSYTQSIDDADSIQEVTQRLDLKT--PNVQSGEFI 277
9628645    81 TTWAIVNSPANLYNYISDYYSRLSPVRPSMVRQVAQREGTYISFGHSYTQSIDDADSIQEVTQRLDLKT--PNVQSGEFI 158
224460772 198 TTWTIVNAPINLYNSIQNYYSALSPIRPSMVRQVAEREGTQVTFGHSYSQSIDDADSIEEVTQRLDLRNKEANVHSGEFI 277
224460773  80 TTWTIVNAPINLYNSIQNYYSALSPIRPSMVRQVAEREGTQVTFGHSYSQSIDDADSIEEVTQRLDLRNKEANVHSGEFI 159
297591900 199 TTWTVINAPVNWYNSLQDYYSTLSPIRPTMVRQVANREGLQISFGHTY-DNIDEADSIQQVTERWEAQSQSPNVQSGEFI 277
297591901  81 TTWTVINAPVNWYNSLQDYYSTLSPIRPTMVRQVANREGLQISFGHTY-DNIDEADSIQQVTERWEAQSQSPNVQSGEFI 159
82524377  278 EKTLAPGGANQRIAPQWMLPLLLGLYGTVTPALEAYEDAPSKKKRRMSRGSSQKAKGPRASSKTSYKRRRRSTRS 352
82524378  160 EKTLAPGGANQRIAPQWMLPLLLGLYGTVTPALEAYEDAPSKKKRRMSRGSSQKAKGPRASSKTSYKRRRRSTRS 234
113204632 277 EKTIAPGGANQRTAPQWMLPLLLGLYGTVTPALEAYEDGPNQKKRRVSRGSSQKAKGTRASAKTTNKRRSRSSRS 351
113204633 158 EKTIAPGGANQRTAPQWMLPLLLGLYGTVTPALEAYEDGPNQKKRRVSRGSSQKAKGTRASAKTTNKRRSRSSRS 232
9628644   278 ERSIAPGGANQRSAPQWMLPLLLGLYGTVTPALEAYEDGPNKKKRR--------KEGPRASSKTSYKRRSRSSRS 344
9628645   159 ERSIAPGGANQRSAPQWMLPLLLGLYGTVTPALEAYEDGPNKKKRR--------KEGPRASSKTSYKRRSRSSRS 225
224460772 278 EKTLAPGGANQRIAPQWMLPLLLGLYGTVTPALEAYEDAPSKKKRRMSRGSSQKAKGPRASSKTSYKRRRRSTRS 352
224460773 160 EKTLAPGGANQRIAPQWMLPLLLGLYGTVTPALEAYEDAPSKKKRRMSRGSSQKAKGPRASSKTSYKRRRRSTRS 234
297591900 278 EKFEAPGGANQRTAPQWMLPLLLGLYGSVTSALKAYEDGPNKKKRKLSRGSSQKTKGTSASAKARHKRRNRSSRS 352
297591901 160 EKFEAPGGANQRTAPQWMLPLLLGLYGSVTSALKAYEDGPNKKKRKLSRGSSQKTKGTSASAKARHKRRNRSSRS 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap