Conserved Protein Domain Family
wac

?
PHA02607: wac 
fibritin; Provisional
Statistics
?
PSSM-Id: 177432
View PSSM: PHA02607
Aligned: 19 rows
Threshold Bit Score: 417.502
Threshold Setting Gi: 34419582
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116326382    1 MIE-LKDLPFVDSVPGE--GQERISWIKNGEEILGASTKYGNDGSMNRPTVSVFKNVEVLDENVGILKTAIETSQKDIKT 77  
157311449    4 QLN-IHEIPHVDGVPSE--GQHRIIWIKNGECLSAATTQTGNDGTLNRAPVAIQENVARVNENAKSTVAKVNEVVTAVND 80  
109290125    4 KIT-KGVIPYVDTTPGD--GQLRIGWIKNGERLSAASTQTSNDGVYNRAPLNIQQNVVQLDEDQAQSFLKINEIVDAVNI 80  
66391950     4 HLT-KGSLPYVDGAPEV--GQARIDWIKNGERLCGASTKTSNDGTYNRPTLNVQKNVEAADGEQVKTVEKVNEIVDTVNI 80  
66391664     4 KLNpLPKIPFVDGVPSDt-TQTPINWIINGETLDGAKTKVTNEGSLNRCGVLVQKNAVQLETNTITQTAKINEVIDQVNL 82  
38640139     5 KVS-QSQLPFVDGVPAV--GQTRIDWIQNGEYTDGAVSATDNGGALNRASVKVQKNVDTINQELNKTKDSLSKVIDLAET 81  
33620663     4 QLN-IHEIPHVDGVPSE--GQHRIIWIKNGECLSAATTQTGNDGTLNRAPVAIQENVARVNENAKSTVAKVNEVVTAVND 80  
37651629     4 HLT-KGSLPYVDGAPEV--GQARIDWIKNGERLCGASTKTSNDGTYNRPTLNVQKNVEAADGEQVKTVEKVNEIVDTVNI 80  
238695029    4 QLN-IRKIPNVDGVPGE--GQHSISWIKNGECLSAATTETGHEGTLNRAPYAIQENIVRLDENSKTTVTKVNEVVTAVND 80  
294661591    5 KLNpLPKIPFVDGVPDDatTQTKIIWIKNGETLDGSPDKVSNTGSLNRTGVNIQQNAVQLEQNTITHNDKINEVIDQVNL 84  
116326382   78 IQGVLDVSGDIEALSQISVNKNDISNLKTLTNEHTDILTGTNNTVDKIIADIGPfNDEENSVYRTIRNDLLWIKQELGQY 157 
157311449   81 IKTTLGVISDGSIIDVVNQTVAKVESVEENLGETARTLQTTVDAVSELNIKIGD-RPAADPSTRTIYDDISFIKQEMGSY 159 
109290125   81 IQDNLGVIGDNTVIDQINANSNDILAIKQDISKVETNLAGVLSLSESTSEKLGH-RYLEDNTTRTVYGDLYWIKTELGAY 159 
66391950    81 IVENLGNIGNTDLIEQVNENTADIVVLKQHVVDATAQDAIFTNDIAEINLSVGQ-RLPADNTTRDVYNDLFWIKTELGAY 159 
66391664    83 ISENLAAISDESVIDKLDQVVADVEVLKVDMTAVQGSTASNTLKIQDLDKEIGTwDASTDPKHRTIRKDIIFLKGEMGAY 162 
38640139    82 HDRILNAQGDGT---NLYDRVTAVEVVNKAQQDRLAKI-----ETDEIEHVAGQ-EAINKRITDTVDPQITNIKKMLGNY 152 
33620663    81 IKTTLGVISDGSIIDVVNQTVAKVESVEENLGETARTLQTTVDAVSELNIKIGD-RPAADPSTRTIYDDISFIKQEMGSY 159 
37651629    81 IVENLGNIGNTDLIEQVNENTADIVVLKQHVVDATAQDAIFTNDIAEINLSVGQ-RLPADNTTRDVYNDLFWIKTELGAY 159 
238695029   81 IKTTLGAVADGSIIDIVNQTIAKVDSVEENLGETSRILQTTVDELAETGKKIGV-RPAADPSTRTIYDDISFIKQELGAF 159 
294661591   85 ITENIDAIGDESVIKKVNQLDQDVRALTLSNTQTQNKVAQLTLSVNAQNDEIGEyDPEKDPKHRTIRNDIIYIKKEVGSY 164 
116326382  158 SGQDINGLPVVGNASTGMKHRIITNSTLLSSQGIRLSELENKFTESDVGSLTVEVGKLRDELGNKPVDFGPNIYNRLNTI 237 
157311449  160 PNFNINGSPDAGSSGSGIKYRVIQNTAALNDHGRRIVQLENDWQDSDVGELTRQVNKMRSEIGDTSLATQENVYVRLRTN 239 
109290125  160 PGFDTNGNSVPSSTGSGLKYRFSQVNQTVSLNTQRITALENSWAQSDVGQLTSDLYDLRMEVGNTNLGTGIPIYTRLNAI 239 
66391950   160 NGFDINGGSAIGSIGSGLKYRFGELNTLVGNNSRRITTLEDNWNASDVGQLTSDLEDMRLEIGRSQLATGIPIYTRLRIL 239 
66391664   163 PGFNENGDVDPTSTGSGMKYKIMTNAQAISIHEGRITRLEDDWANSDVGHLTDEVTDLRNEMGPKHLATFESVYVRLNTI 242 
38640139   153 KGFDQDGNPDINAPGLGVKGQVERNWENVVQHDNRIKSLESFWQGDTPDVLIRNTRDLRAEMGPSSEKTDKTIYQRVKES 232 
33620663   160 PNFNINGSPDAGSSGSGIKYRVIQNTAALNDHGRRIVQLENDWQDSDVGELTRQVNKMRSEIGDTSLATQENVYVRLRTN 239 
37651629   160 NGFDINGGSAIGSIGSGLKYRFGELNTLVGNNSRRITTLEDNWNASDVGQLTSDLEDMRLEIGRSQLATGIPIYTRLRIL 239 
238695029  160 PNFNINGSPDPGSSGSGIKYRVIQNTEALNNHGQRIRQLENDWQDSDVGELTKQVNKMRSELGDTSLATQDNVYLRLRTN 239 
294661591  165 PGFNVDGDVDPSSTGTGLKYRVLSNQRAISMQETRITKLEDDWALSEVGQLTEEVKELRAEMGDSGLATTRSIYARIKIL 244 
116326382  238 DDKQTLINSDIAEIKSSIG---YPENVSIITEINNNKSSIESINNELNQ-SEGVKQRL-TAIETSIGSDDIPSSIKGKIK 312 
157311449  240 ARNIANISNEVLEVKKAIL---FDSIPDIGTKVTTLGTNYELLNNDVNGvDSGIRPRL-LAVENKIGTPQSAGSIDYRLT 315 
109290125  240 ENTLGGGDDDVDQIKIKID---FSNPVSIASRVALNESAMSSLANTMNTpVTGVLSRL-GAVEQKIGDVNTQNTILHDIN 315 
66391950   240 EDGAGGEQDDVEAIKLKID---FSNETSIAARTTLLESTTSSLANTINRpDTGLLPRL-TVVENQIGSTSEPYTMMYDIN 315 
66391664   243 GTEITGINSELTSINQYIGrtgTGGTGSISARMTTAESNIATLQTQMNDsATGVLPRV-ISLENAVGNSQIPGSIRYDIS 321 
38640139   233 EDHVTTANKHLTDIDTAIGkieFPAKYVTSTGTEVTAKDIWEYTKLVRGdVGANQNALnTAINDILLNKSDIKTMKEFDT 312 
33620663   240 ARNIANLSNEVLEVKKAIL---FDSIPDIGTKVTTLGTNYELLNNDVNGvDSGIRPRL-LAVENKIGTPQSAGSIDYRLT 315 
37651629   240 EDGAGGEQDDVEAIKLKID---FSNETTIAARTTLLESTTSSLANTINRpDTGLLPRL-TVVENQIGSTSEPYTMMYDIN 315 
238695029  240 TRNIASISNEVQEVKKAIL---FESIPDIGTKVTKLQSDYTQLNDEVNGvDAGIRPRL-TLLENNIGNPQAAGSIDYRLT 315 
294661591  245 EDGSIVMQNELDAINSYIGr-tSGSTSSINDRVNSLENSVSSLATQINDpVTGITAQI-ATINGQIGTASAQGSIRYDIA 322 
116326382  313 NHTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSggqpspSGSLLNKVSVLEGEVS-VLNNNVQNIQVEIGNNRTGI 391 
157311449  316 NTEREFLDLKQVVGVSGADGLRGEVVRLSNEIGTDSD------RHTLAGRLKVVENTQG-RLEASVQDMEQIVGDRESGL 388 
109290125  316 RNTSNIATITQILGADSSSGIQGDISDLNTVIGSIGE------PSSINGRLYILQTNHN-QMSLSLNDVVSRVGDENSGL 388 
66391950   316 QNAMAIVNINQILGSNGSSGIQGEIALINAAIGPNNE------SGSINGRISVLQQEVS-QITLTLADIDGKIGDENSGL 388 
66391664   322 AIKRDIGDINMIVGESSDDGLRGEMAQVMTDIGTDSQ------PTSIKGRLLNVENTQR-DDHQKLIDVESVVGNTSSGL 394 
38640139   313 SSGAKITNLESLVGLQPTDGMRGDIKALDLRESNNAT--------RLEGMVKTVTDVVNlETTPAVRNLQEDMTKAKPDI 384 
33620663   316 NTEREFLDLKQVVGVSGADGLRGEVVRLSNEIGTDSD------RHTLAGRIKVVENTQG-RLEASVQDMEQIVGDRESGL 388 
37651629   316 QNAMAIVNINQILGSNGSSGIQGEIALINAAIGPNNE------SGSINGRISVLQQEVS-QITLTLADIDGKIGDENSGL 388 
238695029  316 NQEREFVDLKSVVGVSGADGLRGEVARISNTVGTDSE------RHTIAGRLKIVENTQG-RLEASVQDIEQMIGDRDSGL 388 
294661591  323 ETKRRLMDMEMILGESGDDGLQGQVAILTGDVGEDSD------PTSIKGRLSVVEGELR-TNTSALWELQGVVGNSSSGL 395 
116326382  392 KGQVIELTS----------------------------------------------------------------------- 400 
157311449  389 TAGVIKLSS----------------------------------------------------------------------- 397 
109290125  389 VSANILMST----------------------------------------------------------------------- 397 
66391950   389 VGANIIMST----------------------------------------------------------------------- 397 
66391664   395 VAANIAMGK----------------------------------------------------------------------- 403 
38640139   385 YGTNVDTDTpivklgikstnktmyeemylpfksgsgfildtsdqnvdssfvrryvdgkwewknlfsedlvigsnksvrsf 464 
33620663   389 TAGVIKLSS----------------------------------------------------------------------- 397 
37651629   389 VGANIIMST----------------------------------------------------------------------- 397 
238695029  389 TAGVIKLSS----------------------------------------------------------------------- 397 
294661591  396 VATSQQINK----------------------------------------------------------------------- 404 
116326382  401 -----------------LINGNNPD------------------------------------------------------- 408 
157311449  398 -----------------DIYGDDGS------------------------------------------------------- 405 
109290125  398 -----------------DLYGNAAG------------------------------------------------------- 405 
66391950   398 -----------------DLYGDASS------------------------------------------------------- 405 
66391664   404 -----------------AVYGDATS------------------------------------------------------- 411 
38640139   465 dgqravsfalridkppvTVFGDDNTeieirgkitneiditglkyktssvvhftdtqdtfgkgqpvqfkvdgenaltvtyg 544 
33620663   398 -----------------DIYGDDGS------------------------------------------------------- 405 
37651629   398 -----------------DLYGDASS------------------------------------------------------- 405 
238695029  398 -----------------DMYGNPEG------------------------------------------------------- 405 
294661591  405 -----------------EIYGDGVS------------------------------------------------------- 412 
116326382  409 ---------------------------------------------GSTVEERGLTNSVKTNETNIaavthevntakdnis 443 
157311449  406 ---------------------------------------------EDPFTQKGVIKIVKELQTSN--------------- 425 
109290125  406 ---------------------------------------------ITQLERDGIKKTVKESSETL--------------- 425 
66391950   406 ---------------------------------------------IDPFTNAGIKKTTKDLFDTV--------------- 425 
66391664   412 ---------------------------------------------SDPFLKDGIQKTARDSKAAIgvnttgsetgiykli 446 
38640139   545 gtvgtivhsaniknyvadidprtgfrlnrdtsvsaevsignvnviGTSFINKTVKLSDEGMTTQIegevskirmaidaky 624 
33620663   406 ---------------------------------------------EDPFTQKGVIKIVKELQTSN--------------- 425 
37651629   406 ---------------------------------------------IDPFTNAGIKKTTKDLFDTV--------------- 425 
238695029  406 ---------------------------------------------STQLEQDGIVKTVKELSTSN--------------- 425 
294661591  413 ---------------------------------------------SDPVTRAGLKKTTRNLFTQVgdnaegnetgiyali 447 
116326382  444 slqssvqalqeAGYIP-----------------------------------------------EAPKDGQAYVRKDGEWV 476 
157311449  426 -----------GNKVD-----------------------------------------------DVPDDGFHYLRKRGEWV 447 
109290125  426 -----------QLKLD-----------------------------------------------KPLAVGRWYY-ENGVWV 446 
66391950   426 -----------PGKLD-----------------------------------------------RPAETGRWYF-ENGAWK 446 
66391664   447 sdltarvaaleSGTGG-----------------------------------------------ELEQRVSDLETNKASHQ 479 
38640139   625 tgysagnilmnELGVSryvandyvevgdskasaalrtrgddlksvkvvagtgntlytvwhdglDAPKDDAMYARKNGVWT 704 
33620663   426 -----------GNKVD-----------------------------------------------DVPDDGFHYLRKRGEWV 447 
37651629   426 -----------PGKLD-----------------------------------------------RPAETGRWYF-ENGAWK 446 
238695029  426 -----------ASKVT-----------------------------------------------DVPDDGFHYLRKHGEWV 447 
294661591  448 adlnkrvedleALNIA-----------------------------------------------QALADRVTIEDLNAkla 480 
116326382  477 LLS----------------------------------------------------------------------------- 479 
157311449  448 QVAyaagafkntaditveldeqdvykpiplndmaaevnarqmvksesvvtvqdkglfrcvfrcavqaqhn---------- 517 
109290125  447 KATnimvavekkdfqitttetpriipfvdfdqtvangcifesgkikftdgglvnasieietsglletdn----------- 515 
66391950   447 KASsimvaveksafdvdateaevdipfidfeqtiangcvfnngvitfsdnglveakidvevegvgetdn----------- 515 
66391664   480 DVAnalvpyiteaeadvkyepkkiplsftqnlvgrgdyiegddisfmvtvtggklpyvyqwkkgtadvgtnassiliqsi 559 
38640139   705 AFNpggtgggladdapdngmphvrvstngnavwealgskdinlspnigikfnttdhglvsafsplatgaisigydnsksp 784 
33620663   448 QVAyaagafkntaditveldeqdvykpiplndmaeevnarqmvksesvvtvqdkglfrcvfrcavqaqhn---------- 517 
37651629   447 KASsimvaveksafdvdateaevdipfidfeqtiangcvfnngvitfsdnglveakidvevegvgetdn----------- 515 
238695029  448 QVAwaagafkntaqiditldgqdqykgiplndmteevpargmvkseslvtvndkglfrcdfrcsvnaahn---------- 517 
294661591  481 lyikeadadlryesknpplsfgtnltgdteyttgdplslsvtmtggvsplsyqwtkngvnvgtnantftidslqpsdsgt 560 
116326382      --------------------------------------------------------------------------------     
157311449      --------------------------------------------------------------------------------     
109290125      --------------------------------------------------------------------------------     
66391950       --------------------------------------------------------------------------------     
66391664   560 tsadagvykvvvtdadntvitsdevtvavypvpqfdtnladksvvdgdpltle--------------------------- 612 
38640139   785 itfkgrvqaftlgneqalmglttsdevrtivkvdfendimigdentavyfgrqpfvdfngsshrvwhdgidapsdgsyya 864 
33620663       --------------------------------------------------------------------------------     
37651629       --------------------------------------------------------------------------------     
238695029      --------------------------------------------------------------------------------     
294661591  561 ykvtvtdashkvivsdelaitva--------------------------------------------------------- 583 
116326382      --------------------------------------------------------------------------------     
157311449      --------------------------------------------------------------------------------     
109290125      --------------------------------------------------------------------------------     
66391950       --------------------------------------------------------------------------------     
66391664   613 -------------------------------------vvysggkppytyewfkdnsvisgetsatftksavtsadageyy 655 
38640139   865 rnngtwqkvfngvdptadvnttgafksrgmnigfteqvgtdyivqlgqsnqytklngkvmdimlaqpvdngqtsikgmlk 944 
33620663       --------------------------------------------------------------------------------     
37651629       --------------------------------------------------------------------------------     
238695029      --------------------------------------------------------------------------------     
294661591      --------------------------------------------------------------------------------     
116326382      --------------------------------------------------------------------------------     
157311449  518 --------------------atfivaifkngqmvyeaknghygtdelisystsaflniekgdqinirikgvsveavaqpv 577 
109290125  516 ---------------------leisiahtsggitsytnlqeftlrsngrlyvrnwlynvilddtiaiyvkaldpssaksi 574 
66391950   516 --------------------yevaishdvggvvtrtvlqefahrpigkrlytrdwlytissgdkvsvtikaldsssvktv 575 
66391664   656 vsvtdamnnqndsvkatvtvtprpalafttdlsatksystganmdlavvvtggktpytykwfkdtaeisgqtgaslttva 735 
38640139   945 gaelnviaikdnvagnnhvivgdasaemrinckeayingntvitsafdvptddkrysrrngkwiqsyyygnfatnapatp 1024
33620663   518 --------------------atfivaifkngqmvheaknghygtdelisystsaflniengdqinirikgvsaeavaqpv 577 
37651629   516 --------------------yevaishdvggvvtrivlqefahrpigkrlytrdwlytissgdkvsvtikaldsssvktv 575 
238695029  518 --------------------atfvvgiaknglivhevrnghygpddlisystsaflniekgdridirikgvseealaqql 577 
294661591      --------------------------------------------------------------------------------     
116326382  480 ------TFLSPA 485 
157311449  578 qikeflFGISPV 589 
109290125  575 tigkmsAVIVPA 586 
66391950   576 nitdmsIMIVPV 587 
66391664   736 edgvykVEVTDA 747 
38640139  1025 vegdvfFEFVN- 1035
33620663   578 qikeflFGISPV 589 
37651629   576 nitdmsIMIVPV 587 
238695029  578 qikeflFGISPV 589 
294661591      ------------     
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap