Conserved Protein Domain Family
54

?
PHA02605: 54 
baseplate subunit; Provisional
Statistics
?
PSSM-Id: 177430
View PSSM: PHA02605
Aligned: 17 rows
Threshold Bit Score: 423.872
Threshold Setting Gi: 294661513
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157311485   1 MFDLNDFNEQAANLDFQRSNLFSVAFATTPSNK---------TQAILESMGGAVYDIIPNAlNDYFGITRGDYTDALTNL 71 
161622624   1 MYTLQEFQNQAINIDLQRNNLFSVVFATVPSSK---------SQALLDQFGGALFNNIPLN-TDLFGITQGDLTQGVTTL 70 
109290162   1 MYKLDEFQQE-LNKDFQRTNMFSVVFATTPSSK---------TTDLLDGFGAYLYNNLPFG-KDFAGLTQGMLSSTLNKV 69 
66391557    2 FYSVDEFLSGMANKDFQRSNLFSVVFATSPASRildstigsiRDTLIDGTMSSINANNP---NEFMNAITGGVSKLFSYT 78 
66391987    1 MYRLDEFQQE-LNKDFQRSNMFSVVFATTPSSK---------TTELLDGFGGFLYNNLPFG-KDFAGLTQGMISSSLNKI 69 
33620696    1 MFDLNDFNEQAANLDFQRSNLFSVAFATTPSNK---------TQAILESMGGAVYDIIPNAlNDYFGITRGDYTDALTNL 71 
37651666    1 MYRLDEFQQE-LNKDFQRSNMFSVVFATTPSSK---------TTELLDGFGGFLYNNLPFG-KDFAGLTQGMISSSLNKI 69 
238695347   1 MYTLQEFQNQAINIDLQRNNLFSVVFATVPSSK---------SQALLDQFGGALFNNIPLN-TDLFGITQGDLTQGVTTL 70 
238695066   1 MFDLNDFNEQAANLDFQRSNLFSVAFATTPSNK---------TQAILESMGGAVYDIIPNAlNDYFGITRGDYTDALTNL 71 
304373652   2 FYSVDEFLSGMANNDFQRSNLFSVVFATSPASRildstigsiRDTLIDGTMSSINANNP---NEFMNAITGGVRKLFSYT 78 
157311485  72 AVQGVRRAVDSSGVKKYLLGAMSSRVVQSLLGQFDVGTYALDWFNMAYKTSGLLVYAVKVPENRLNYEMDRNHNAPNIRI 151
161622624  71 VTAGTQKLIRKSGISKYLIGAMSSRVVQSLLGEFEVGTYLMDFFNMAYPTAGLLVHAVKIPDNTLNYEMDLNHNSPNIKI 150
109290162  70 IVQGTQNIIRKSGVSKYLIGAMTSRTIQSLLGQFEVGTYLLDFFNAGNTHTGLTVYSVKMPENRLNYEMDKFHNAPNIKL 149
66391557   79 VDKAIMSL-NKTGFSK-IMGALSPRLVTSLFGDSVYGQLLTEFRDKMMYNMGLSIVGVQLPGKTLGYEYVYNGGVPQIRF 156
66391987   70 IVQGTQSVMRSSGVSKYLIGAMTSRTVQSILGQFEVGTYLLDFFNAGNTHTGLTVYSVQMPENRLGYEMDKFHNAPNIKL 149
33620696   72 AVQGVRRAVDSSGVKKYLLGAMSSRVVQSLLGQFDVGTYALDWFNMAYKTSGLLVYAVKVPENRLNYEMDRNHNAPNIRI 151
37651666   70 IVQGTQSVMRSSGVSKYLIGAMTSRTVQSILGQFEVGTYLLDFFNAGNTHTGLTVYSVQMPENRLGYEMDKFHNAPNIKL 149
238695347  71 VTAGTQKLIRKSGISKYLIGAMSSRVVQSLLGEFEVGTYLMDFFNMAYPTAGLLVHAVKIPDNTLNYEMDLNHNSPNIKI 150
238695066  72 AVQGVRRAVDSSGVKKYLLGAMSSRVVQSLLGQFDVGTYALDWFNMAYKTSGLLVYAVKVPENRLNYEMDRNHNAPNIRI 151
304373652  79 VDKAIMSL-NKTGFSK-IMGALSPRLVTSLFGDSVYGQLLTEFRDKMMYNMGLSIVGVQLPGKTLGYEYVYNGGVPQIRF 156
157311485 152 TGRDFDPLVLSFRMDSSASNYRAMQDWVNSVEDPVTGLRALPVDVEADIQVNLHNRMGVPHTIMMFNGCVPVGVSAPELT 231
161622624 151 TGREYSPLVLSFRMDSEAANYRAFNDWVNSVQDPITQLRALPEDVEADIQVNLHSRNGLPHTVVMLNGCVPVSVSSPELS 230
109290162 150 MGREYDPLIISFRMDHQAANYRAMQDWVNAVEDPVTGLRSLPADVEADIQVNLHARDGMPHTVTMFNGCIPVSVSAPELS 229
66391557  157 TRPENGELSLTFRVDSEARNLKVFNEWISAIRDDITGQFAFIDEVSSAIQVNLHNRDGVPHSTYIFQKCLPVKVSSPELS 236
66391987  150 MGREYDPLVISFRMDHQASNYRAMQDWVNAVEDPVTGLRSLPADVEADIQINLHARDGIPHTVTMFGGCIPVAVSSPELS 229
33620696  152 TGRDFDPLVLSFRMDSSASNYRAMQDWVNSVEDPVTGLRALPVDVEADIQVNLHNRMGVPHTIMMFNGCVPVGVSAPELN 231
37651666  150 MGREYDPLVISFRMDHQASNYRAMQDWVNAVEDPVTGLRSLPADVEADIQINLHARDGIPHTVTMFGGCIPVAVSSPELS 229
238695347 151 TGREYSPLVLSFRMDSEAANYRAFNDWVNSVQDPITQLRALPEDVEADIQVNLHSRNGLPHTVVMLNGCVPVSVSSPELS 230
238695066 152 TGRDFDPLVLSFRMDSSASNYRAMQDWVNSVEDPVTGLRALPVDVEADIQVNLHNRMGVPHTIMMFNGCVPVGVSAPELN 231
304373652 157 TRPENGELSLTFRVDSEARNLKVFNEWISAIRDDITGQFAFIDEVSSAIQVNLHNRDGVPHSTYIFQKCLPVKVSSPELS 236
157311485 232 YENNNEITTFDVVFAYRTMQTGAVGEQAAREWIEDKAINAITNTFGNNlldsGLSAAGNALSRLNGVGGRVVNTVTNWF 310
161622624 231 YDGDNQIASFDVTFAYRSVQTGAVGKQAAYEWLEDKVLKGVAGISESN----SLSASVAKLSRLSGASSGLTGLVNTFG 305
109290162 230 YEDNNAITTFDVTFAYRVMNTGAVNQAMLEDWLKGDLLPELGKQAGGW------------LSKFGSFG----------- 285
66391557  237 YETNNEIWTFTVDFAYKT------------AWIVEADKEGWDGF---------------KQSMIEGAAVALRGVVSGQ- 287
66391987  230 YEDNNTITTFNVTFAYRVMSVGAVNMAMVDDWLKGDLLPALGSQAGGW------------LSKFGPFS----------- 285
33620696  232 YENNNEITTFDVTFAYRTMQTGAVGEQAAREWIEDKAINAITNTFGNNlldsGLSAAGNALSRLNGVGGRVVNTVTNWF 310
37651666  230 YEDNNTITTFNVTFAYRVMSVGAVNMAMVDDWLKGDLLPALGSQAGGW------------LSKFGPFS----------- 285
238695347 231 YDGDNQIASFDVTFAYRSVQTGAVGKQAAYEWLEDKVLKGVAGISESN----SLSASVAKLSRLSGASSGLTGLVNTFG 305
238695066 232 YENNNEITTFDVTFAYRSMQTGAVGEQAAREWIEDKAINAITNTFGNNlldsGLSAAGNALSRLNGVGGRVVNTVTNWF 310
304373652 237 YETNNEIWTFTVDFAYKT------------AWIVEADKEGWDGF---------------KQSMIEGAAVALRGVVSGQ- 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap