Conserved Protein Domain Family
56

?
PHA02602: 56 
dCTP pyrophosphatase; Provisional
Statistics
?
PSSM-Id: 177427
View PSSM: PHA02602
Aligned: 17 rows
Threshold Bit Score: 284.336
Threshold Setting Gi: 157311316
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
32453512    1 MAHFNECSQLIS--GVDKAEEAYFNaLIHEDKDPLQVMLDMQKSLQVRLANDKpEHNKHPDELATAGDVVDWLRNQKDYI 78 
37651507    3 TPQFNECSQLID--NLHKAQNALEG-CLSVHHNPLDRMIDMQRQLQIELAERHpKYNKDPRTLKTCGEILEWCQKQDDYI 79 
33620438    1 MSEFNSCAGLVNekDINAAIAAYHH-AIAEGKDPFQVMLEMQTGLQVALSEKF-DWVPNPTKLETCGEMLDWMQRMDDAI 78 
66391477    5 TPVFNSCAHLVNpaDLEFVDNEYKK-VLARNGDPLQSMLDLQDHAQQSLSDTL-SWVPRPDGLKTCGEILDWLKLQDDAI 82 
66391829    3 TPQFNECSQLID--NLHKAQNALEG-CLSVHDNPLDRMIDMQRQLQIELAERHpKYNKDPRTLKTCGEILEWCQKQDDYI 79 
109290010   2 TPQFNECAQLAN--DMDKAANALND-CLSAHDNPLNRMIDMQRQLQIELAQRHpKYNRDPRELKTCGEILDWCQAQDDYI 78 
161622406   1 MAHFNECSQLIA--GADKAEEAYFNaLIHEDKDPLQVMLDMQKSLQVRLAKDKpEYNRHPDDLATAGEVVDWLRNQKDYI 78 
157311316   1 MSEFNSCAGLVNekDINAAIAAYHH-AIAEGKDPFQVMLEMQTGLQVALSEKF-DWVPNPTKLETCGEMLDWMQRMDDAI 78 
238695182   1 MAHFNECSQLIA--GADKAEEAYFNaLIHEDKDPLQVMLDMQKSLQVRLAKDKpEYNRHPDDLATAGEVVDWLRNQKDYI 78 
294661444   6 TPVFNSCAHLVNpeDLEFVDSEYQK-VLARNGDPLQSMLDLQNHAQQSLSDTL-HWVPRPDNLETCGEILDWLKLQDDAI 83 
32453512   79 DDEFRELLTSLGGMSNGEKAASSVWKPWKAQHAEYRNRRIDELSPEDQLEIKFEMIDILHFVLNMFQGLGLTAEEIFKLY 158
37651507   80 ADEVREHYTSLGGMSN--PKPNAIWKPWRAEHGEYRDRLFSDLSAEDQLEAKFELIDQMHFVLNKFIAMGMDGNEIFKLY 157
33620438   79 ADETRELYTSLGGMSNG-KDASAIWKMWKKNHGEARARKFSELSPEDQLEVKFEFVDAIHFILSKMIPLGIDAQELFILY 157
66391477   83 ADETRELYTALGGMSRGVKPASGVWKPWKANHQELRNQVFAEMSEEDKLEILFEMIDQWHFFMCKFLALGMDAETIYKLY 162
66391829   80 ADEVREHYTSLGGMSN--PKPNAIWKPWRAEHGEYRDRLFSDLSAEDQLEAKFELIDQMHFVLNKFIAMGMDGNEIFKLY 157
109290010  79 ADEIREHYTALGGMSN--PKPNAIWKPWRAEHDEYRNRLFSELSPEDQLEAKFELIDQMHFVLNKIIAMGMDGDEIFKLY 156
161622406  79 DDEFRELLTSLGGMSNGEKDASAVWKPWKAQHAERRETLINDLSPEDQLEIKFEMIDILHFVLNMFQGLGLTAEEIFKLY 158
157311316  79 ADETRELYTSLGGMSNG-KDASAIWKMWKKNHGEARARKFSELSPEDQLEVKFEFVDAIHFILSKMIPLGIEAQELFILY 157
238695182  79 DDEFRELLTSLGGMSNGEKDASAVWKPWKAQHAERRETLINDLSPEDQLEIKFEMIDILHFVLNMFQGLGLTAEEIFKLY 158
294661444  84 ADETRELYTALGGMSRGVKPASGVWKPWKANHQELRNTKFADLSEEDRLEVLFELIDQWHFFMCKFLALGMDAETIYKLY 163
32453512  159 YLKNAENFARQDRGY 173
37651507  158 YLKNAENFDRQERGY 172
33620438  158 YLKNAENFARQERGY 172
66391477  163 ALKQAENLRRWANNY 177
66391829  158 YLKNAENFDRQERGY 172
109290010 157 YLKNAENFARQENGY 171
161622406 159 YLKNAENFARQDRGY 173
157311316 158 YLKNAENFARQERGY 172
238695182 159 YLKNAENFARQDRGY 173
294661444 164 ALKQAENLRRWANNY 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap