Conserved Protein Domain Family
FII

?
PHA02600: FII 
major tail tube protein; Provisional
Statistics
?
PSSM-Id: 164995
View PSSM: PHA02600
Aligned: 11 rows
Threshold Bit Score: 246.548
Threshold Setting Gi: 27311208
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9630350     1 MAMPRKLKLMNVFLNGYSYQGVAKSVTLPKLTRKLENYRGAGMNGSAPVDLGLDDdaLSMEWSLGGFpDSVIWELYAATG 80 
17313242    1 MAMPRKLKNMNLFNDGGSYQGVVKSCTLPPLARKMEAFRGGGMNGPVKADLGFDDdgIQFEWTLGGL-DLTALKQYGAVS 79 
30065726    1 MAMPRKLKLMNVFLNGYSYQGVAKSVTLPKLTRKLENYRGAGMNGSAPVDLGLDDdaLSMEWSLGGFpDSVIWELYAATS 80 
27311208    1 -MLPQVIRAMNLFADGKGYAGVVEEVTPPKLTLKTEEFKAGGMDAPLELDQGMEK--LECNFTVASY-EKELFAAYGLVP 76 
41057374    1 MALPRKLKYLNMFNDGLSYMGVVESVTLPKLTRKLENYRGGGMNGAAAIDLGLDDdaLTVEWSVGGLpDVALWAQYAAPG 80 
109289961   1 MGLPAKLKNFNFSVDGTSYLGETTEVTQPKLAMQLEDYRAGGMIAPVGVNMGLEK--LELEFKIGGH-EEDLLKLFGG-S 76 
72537698    1 MGMPRKLKGFNVFHNGANFVGEVEELNLPKLKRKMEAWQGSGMTGPVKIDYGSEE--LQLEWTCGGF-MVEVLEQYGAVQ 77 
169936024   1 MALPRKLKHLNLFNDGNNWQGIVESLTLPKFTRKFEKYRGGGMPGAVDVDMGLDDgaLDTEFSIGGT-ELLLFKQMGKAT 79 
145708102   1 MALPRILKHFNVFADGVVHTGECEEINLPKLARKLEEYRAGGMNGAIQIDMGNEK--LELETTYGGP-MREILKQYGTTA 77 
134288759   1 MGMPRKLKGFNVFHNGANFVGEVEELNLPKLKRKMEAWQGSGMTGPVKIDYGSEE--LQLEWTCGGF-MVEVLEQYGAVQ 77 
134288724   1 MGMPRKLKGFNVFHNGANFVGEVEELNLPKLKRKMEAWQGSGMTGPVKIDYGSEE--LQLEWTCGGF-MVEVLEQYGAVQ 77 
9630350    81 VDAVPIRFAGSYQRDDTGETVAVEVVMRGRQKEIDTGEGKQGEDTESKISVVCTYFRL-TMDGKELVEIDTINMIEKVNG 159
17313242   80 ANGVMLRFAGSFQQDDTGEVTSVEIVVRGRHETIEMGDAQPGEDTEHKITTTCSYYKL-VVNGEEVIEIDLLNFVEKVNG 158
30065726   81 ADAVPIRFAGSYQRDDTGETVAVEVVMRGRQKEVDTGEGKQGEDTESKLPVICTYFKL-TMDGKELVEIDTINMIEKVNG 159
27311208   77 GKMINVTLRGAFEQD--GETREVVMVLNGSWKELDFGTWKSGEKAQLKVAVGLQEVETkNPTGEEKVFIDIPNMVRRING 154
41057374   81 ADAVPLRFAGSYQRDDTGEIVAVEVVMRGRHKEIDGGENKQGENTSTKLSTVCTYYRL-TIDGSDVIEIDTVNMVEKVNG 159
109289961  77 ISGNAFRFNGAYQHDDDDSVDAVELVCRGRIAEIDEGSSKAGDDTEHSYKASLTYYKK-TVNGVDIIEIDTLNQIYIVDG 155
72537698   78 HDGVLLRFAGGYRREDSKKHDQIEVVVKGRHEEIDMGTAKAKEDTKFKITTNASYYKL-TVNGRDLIELDFVNAVEKING 156
169936024  80 VDGIQLRFTGSIQRDDTGEVQAVELVVRGRHKEVDSGEWKTGESSSTKVSSTNSYAKL-TINGEVLYEVDLVNMVEIVGG 158
145708102  78 VDGAMIRFAGAYQHEDTKEVDAVEIVVRGRHTEIDFGTAKAGAKAPFKVKSSLTYYKM-TVNGEVWCELDFVNFVEVVFG 156
134288759  78 HDGVLLRFAGGYRREDSKKHDQIEVVVKGRHEEIDMGTAKAKEDTKFKITTNASYYKL-TVNGRDLIELDFVNAVEKING 156
134288724  78 HDGVLLRFAGGYRREDSKKHDQIEVVVKGRHEEIDMGTAKAKEDTKFKITTNASYYKL-TVNGRDLIELDFVNAVEKING 156
9630350   160 VDRLEQHRRNIGL 172
17313242  159 KDLLEAQRKAIGL 171
30065726  160 VDRLEQHRRNIGL 172
27311208  155 TDLLEAARKAIGL 167
41057374  160 VDRLEQHRRAIGL 172
109289961 156 KDRLAEIRKAMGL 168
72537698  157 MDLASDLRRAMGL 169
169936024 159 VDLMEAHRNALGL 171
145708102 157 EDRLAAQRRAIGL 169
134288759 157 MDLASDLRRAMGL 169
134288724 157 MDLASDLRRAMGL 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap