Conserved Protein Domain Family
PHA02591

?
PHA02591: PHA02591 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 164986
View PSSM: PHA02591
Aligned: 2 rows
Threshold Bit Score: 144.822
Threshold Setting Gi: 22122274
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22122274  1 MKVERYKCKKIEKTLNTSLCICYIGEKKMQKVVQVGQTRYFVESEDDLISVTHELARKGFTVEKIASLLGVSVRKVRRYL 80 
22122327  1 MKVERYKCKKIEKTLNTSLCICYIGEKKMQKVVQVGQTRYFVESEDDLISVTHELARKGFTVEKIASLLGVSVRKVRRYL 80 
22122274 81 ESC 83 
22122327 81 ESC 83 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap