Conserved Protein Domain Family
8

?
PHA02580: 8 
baseplate wedge subunit; Provisional
Statistics
?
PSSM-Id: 177409
View PSSM: PHA02580
Aligned: 19 rows
Threshold Bit Score: 577.073
Threshold Setting Gi: 34419576
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161622589   1 MINSTVVYRSIVTSKFRTEKMYNFYRTIGDGEDQNTMYVSFGRARPWADNENDPGFAPPYPVDDSEGVEDVWTNMMGCVK 80 
157311441   2 ANENSVIYRSIITSKFRTEKLLNFYNSVGDGANQITIYGTFGRSEPWSENEKEVGFAPPYPTDSTAGVVDMWTHMMGAVK 81 
66391945    1 ---MSNFYRAIVTSKFRTKNLLNFYDMVGDEPTKNTIYASFGRDTPWSSNETDPGFAPPYPNDSIDGIVDMWTNMLGMVK 77 
66391659    1 -MAQQNIYRAVVTGKFRTENMMNFRDMIGDDPDHNSIYMSIGRTEQWADNESDPEFAPPYPNDDTDGIVDMWTHMIGATK 79 
38640134    1 --MSSIIYRSIVTNKFRTENLLNFYNSVGDTQDKHTIYATFGRPDKWADNETDSKFAPPYPDDSIEGIADVWSRMLGAVK 78 
37651624    1 ---MSNFYRAIVTSKFRTKNLLNFYDMVGDEPTKNTIYASFGRDTPWSSNETDPGFAPPYPNDSIDGIVDMWTNMLGMVK 77 
33620691    2 ANENSVIYRSIITSKFRTEKLLNFYNSVGDEANQITIYGTFGRSEPWSENEKEVGFAPPYPTDSTAGVVDMWTHMMGAVK 81 
109290120   1 ---MSNFYRAIVTSKFRTKNLLNFYDMVGDEPTKNTIYATFGRDTPWSTNETDVGFAPPYPNDSIDGIVDMWTNMLGAVK 77 
238695021   2 ANENSVIYRSIITSKFRTEKLLNFYNSVGDGANQITIYGTFGRSEPWSENEKEVGFAPPYPTDSTAGVVDMWTHMMGAVK 81 
294661584   1 -MAQQNLYRSVITAKFRTENLMNFKDMIGDAADLNTIYMSIGRTESWADNESDPNFAPPYPNDSTDGVSDMWTHMIGATK 79 
161622589  81 VYKSMLDCVVPRKDWGDTTYPNPFTFQIGEIVVANSQPQNRTDVGAGWMVYRCVDIPESGTCSILSLDNKTECIKLGGKW 160
157311441  82 INKSLLDAVIPRKDWGDTGQDNPRTFFINDIVVVNSAPYNRTDVGSGWMVYRVTDVPDRGYCSISSIDAKVECLKLGGKW 161
66391945   78 IDKSLLDAIIPRKDWGDIRYDNPKTFFIDDIVVVNSAVYNRTDSSTGWMIYRCVDVPNIGSCSIDGIDDKIECITIGGKW 157
66391659   80 VPGEMIDAIVPRKDWGDTRYPNPKIFYVNDIVVVNSAPYNRTDYGKGWMIYRVVDVPDIGSCSISSITGKVECVRIGGIW 159
38640134   79 IQQELLRPVVPRDDWGDQRFTDPFIHHIGDIVVTNSAPYNRTEIGSGWMIYRCVDVPEVGQCSIKSIVEKGECMKIGGKW 158
37651624   78 IDKSLLDAIIPRKDWGDIRYDNPKTFFIDDIVVVNSAVYNRTDSSTGWMIYRCVDVPNIGSCSIDGIDDKIECITIGGKW 157
33620691   82 INKSLLDAVIPRKDWGDTGQDNPRTFFINDIVVVNSAPYNRTDVGSGWMVYRVTDVPDRGYCSISSIDAKVECLKLGGKW 161
109290120  78 IDKSLLDAIIPRKDWGDIRYDNPKTFFIDDIVVVNSATYNRTDSSVGWMIYRCADVPSIGSCSISGIDDKIECITIGGKW 157
238695021  82 INKSLLDAVIPRKDWGDTGQDNPRTFFINDIVVVNSAPYNRTDVGSGWMVYRVTDVPERGYCSISSIDAKVECLKLGGKW 161
294661584  80 VPGDMIDAILPRKDWGDTRYPNPKIFYFNDIVVVNTAPYNRTDPGKGWMVYRVVDVPDIGSCSISSITGKLECISIGGIW 159
161622589 161 TSNVQSVKAPAGQGDTegmVDTGDGYLWEYLYEIPPDVSINRCTNEYIVVPWPEEIAEDPERWGYENNLTWQqDDYGLIY 240
157311441 162 TPTHESIAPPVGKGDS---IDMGDGYRWEYLYTIPPDAAINRCTNEHIVVPFPDELRQDPARWGYDNVITWY-NDYNLLY 237
66391945  158 TATHESVEPPRGTAMA---IDMGDGYIWEYLYTIPPDVSINRCTNEHIVVPFPDELVADPARWGYENTILWYpDDIDLVY 234
66391659  160 TPTHESVEPPRGEANG---IDMGDGYKWEYLYTIPPDVVINRCTNEHIVVPFPDELEEDPVRWGYDNVIKWYpDMYDLVF 236
38640134  159 TPSRESLL-PVGKSDG---VDMKDGYIWEYLYTIPPDVAINECTNEHIVVPTPQELIASPSRWGYQHVLKWYpNKYDVIY 234
37651624  158 TATHESVEPPRGTAMA---IDMGDGYIWEYLYTIPPDVSINRCTNEHIVVPFPDELVADPARWGYENTILWYpDDIDLVY 234
33620691  162 TPTHESIAPPVGKGDS---IDMGDGYRWEYLYTIPPDAAINRCTNEHIVVPFPDELRQDPARWGYDNVITWY-NDYNLLY 237
109290120 158 TATHESVEPPRGTAMA---IDMGDGYVWEYLYTIPPDVSINRCTNEHIVVPFPDELSDDPARWGYENAILWYpDKLDLIY 234
238695021 162 TPTHESIAPPVGKGDS---IDMGDGYRWEYLYTIPPDAAINRCTNEHIVVPFPDELRQDPARWGYDNVITWY-NDYNLLY 237
294661584 160 SPSHESSEPPRGEANG---IDMGDGYKWEYLYTIPPDVVINRCTNEHIVVPFPGELEEDPVRWGYDNVIQWYpGQYDLVY 236
161622589 241 RIKANTIRFKAFLDSVYFPEFSLPGNKGFRQLSIISNPLEAKAHPSDPIIKAEKEYYDVIDLSRHSGEMIYMENRPPVIR 320
157311441 238 RLKVVTLRFQAYMDSAQFPTTALVGNTGFRQLSIILNPLEKKARPSDPDVKAVQDKYRPQDLEPHSGEMIYMENRQPIVR 317
66391945  235 RVKVDTLRFRAYMDSIYFPEASLPGNTGFRQMSVILNPLVKKNQPADTDVKATEVAYKPEQLEKDSGEMVYMENRQPITR 314
66391659  237 RMKVHSMRFRAYMDSLFFPQASLPGNRGFRQISVIVNPLLKKAQPTDPEVKATGQFYTKDQFELDSGQMIYMENRQPIIR 316
38640134  235 RMKCHTLRFRAYIDSIYFKEASMVGNKGFRQLSVILDPILMKTNPASADVKATGANYLPTQLERHSGEMIYMENRQPIIR 314
37651624  235 RVKVDTLRFRAYMDSIYFPEASLPGNTGFRQMSVILNPLVKKNQPADTDVKATEVAYKPEQLEKDSGEMVYMENRQPITR 314
33620691  238 RLKVVTLRFQAYMDSAQFPTTALVGNTGFRQLSIILNPLEKKARPSDPDVKAVEDKYRPQDLEPHSGEMIYMENRQPIVR 317
109290120 235 RVKVDTLRFRAYMDSIYFPEASLPGNTGFRQMSIIINPLVKKSAPADPDEKAILAAYKPNELEKDSGEMIYMENRQLITR 314
238695021 238 RLKVVTLRFQAYMDSAQFPTTALVGNTGFRQLSIILNPLEKKARPSDPDVKAVKDKYRPQDLEPHSGEMIYMENRQPIVR 317
294661584 237 RLKVNSMRFRAYMDSLFFPQSTLPGNKGFRQISIIVNPLIKKASPTEPEKKATGDYYNANALEPDSGRMIYMENRQPIIR 316
161622589 321 SMDQTEEINIVFEF 334
157311441 318 SLDQTELVSVLFEF 331
66391945  315 ALDQTEEINIIFSF 328
66391659  317 SPDQTEEVSIIFEF 330
38640134  315 SRDQTEEFNLVFEF 328
37651624  315 ALDQTEEINIIFSF 328
33620691  318 SLDQTELVSVLFEF 331
109290120 315 ALDQTEEINIIFSF 328
238695021 318 SLDQTELVSVLFEF 331
294661584 317 SLDQTEEVSIVFEF 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap