Conserved Protein Domain Family
7

?
PHA02579: 7 
baseplate wedge subunit; Provisional
Statistics
?
PSSM-Id: 177408
View PSSM: PHA02579
Aligned: 19 rows
Threshold Bit Score: 1511.17
Threshold Setting Gi: 34419575
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
34419575     3 NVLQAPPIMEVSINKLTRNYAELSWTTVGENFRYEIHVRSAVSAELLLTQPFAPLYPN-PFTAETRLFTNI-NESVRYYQ 80  
109290119    1 MIIKAPAVTSLKIKILSANQVYLTWDDVGSNFYYIVELLQTRAGYGTS-------WGQlGVTSVEEWFEDTsIQADTYYK 73  
33620635     1 -MIKAPSVTSLTIEKLSANQAYITWDDVGENFFYFVELAETRTRDGEIIPVDELSWVNlGYTAEQNWFEDKnLFPEYYYK 79  
37651623     1 MVIKAPSVTSLKIKILSANQVYITWDDVGSNFYYIVELARTRDS-------SVINWTTlGITPNEEWFEDKvIQSDTHYK 73  
66391658     1 -MIKAPSITSLRVDKLAANFVYLKWDSVGMDFYYVVEMAETRGAGGAVIPDADLTWFQlGYAYANEWFSTA-VQPNSFYK 78  
66391944     1 MVIKAPSVTSLKIKILSANQVYITWDDVGSNFYYIVELARTRDS-------SVINWTTlGITPNEEWFEDKvIQSDTHYK 73  
157311440    1 -MIKAPSVTSLTIEKLSANQAYITWDDVGENFFYFVELAETRTRDGEVIPVDELSWVNlGYTAEQNWFEDKnLFPEYYYK 79  
238695020    1 -MIKAPSVTSLTIEKLSANQAYITWDDVGENFFYFVELAETRTRDGEIIPVDELSWVNlGYTAEQNWFEDKnLFPEYYYK 79  
304373749    1 -MIKAPSITSLRVDKLAANFVYLKWDSVGMDFYYVVEMAETRGAGGAVIPDADLTWFQlGYAYVNEWFSTA-VQPDSFYK 78  
294661583    1 -MIKAPSITSLRVDKLAANFVYLKWDDVGMDFYYVVELARSRDMDGTIIPDEELIWTQlGYSYENEWFSDQ-VAPNTRYK 78  
34419575    81 WRIRSVYQGFNPSEWIQSDIGYTSETNDYDIVTQDEFTPASSFIEARLNNDNVQYLN-SRNQLQATLVRPGFEFDPNMFN 159 
109290119   74 MRVRVSGKGFEMSDWVETEEFQTFSENAYYISAMKEFTPAASFVREKFSKNNENYVNfNTDVIMASLMSEDFVFSNQFTD 153 
33620635    80 FRVAVAAEGFEQSKWVETEEFQTFKTNAYNFSMMREFNLANEFIKEKFTYDNREYVKfNTDLIQASLMKEDFVFSPEYAN 159 
37651623    74 MRVRVSGKGFEMSDWVETEEFQTFNTNAYYVSSMREFTPAATFINEKFTKNNKSYVDfNDDVIMASLMGEDFVFSPQFSN 153 
66391658    79 FRIKVTHQGFEPSDWVYSDELWTFTLNAYAYSTMREFTPSDAFINEKFAKNNQNYVNfNNDVIMAALMKEDFVFSPLYTD 158 
66391944    74 MRVRVSGKGFEMSDWVETEEFQTFNTNAYYVSSMREFTPAATFINEKFTKNNKSYVDfNDDVIMASLMGEDFVFSPQFSN 153 
157311440   80 FRVAVAAEGFEQSKWVETEEFQTFKTNAYNFSMMREFNLANEFVKQKFTYDNRDYIKfNTDLIQASLMKEDFVFSPEYAN 159 
238695020   80 FRVAVAAEGFEQSKWIETEEFQTFKTNAYNFSMMREFNLANEFVKQKFTYDNRDYIKfNTDLIQASLMKEDFVFSPEYAN 159 
304373749   79 FRIKVTHQGFEPSDWVYSDELWTFTLNAYAYSTMREFTPSDAFINEKFAKNNQNYVNfNTDVVMAALMKEDFVFSPLYTD 158 
294661583   79 FRIQTTHEGFEPSDWVISDELWTFDENAYAYTTMREFTPADSFINEKFAKNNRDYVDfNDDVIMASLMVEDFVYSPLYSD 158 
34419575   160 ADSAAYWFVTNPGFSANYGKVPSVCQSNSRVIPSVIDDVIYAFERWQQVCKVSNDGGKTWQTYKATNSRLGSPVYDCICK 239 
109290119  154 ATNLYDKIVSNENYHEIQGFIEPVCVDKNRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRVGNPVSRTVTY 233 
33620635   160 MTNISNYIVVDENFHEIQDHIEKVCTDINRTMLAEMNGVLYLFERFQPIVKVSNDKGQSWKAYKAFNDRVGNPVSRTCVY 239 
37651623   154 ATNIADKIVTDENYHEIQGYIEGVCADIDRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRIGNPITRTVTY 233 
66391658   159 VSQISDKILTQENYHEIQDHIEHVCNDINRTFLVASNGLLYLFERFQNMAKVSNDKGQTWHYYKAFNDRVGNPVARSIAY 238 
66391944   154 ATNIADKIVTDENYHEIQGYIEGVCADIDRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKAFNGRIGNPITRTVTY 233 
157311440  160 MTNISNYIVVDENFHEIQDHIEKVCTDINRTMLAEMNGVLYLFERFQPIVKVSNDKGQSWKAYKAFNDRVGNPVSRTCVY 239 
238695020  160 MTNISNYIVVDENFHEIQDHIEKVCIDINRTMLAEMNGVLYLFERFQPIVKVSNDKGQSWKAYKAFNDRVGNPVSRTCVY 239 
304373749  159 VSQISDKILTQENYHEIQDHIEHVCNDINRTFLVASNGLLYLFERFQNMAKVSNDKGQTWHYYKAFNDRVGNPVSRSVAY 238 
294661583  159 VSQISDKILKQESYHEIQDHIEHVCNDIDRTFLVYSNGLLYLFERFQNMAKVSNDKGQTWYYYKALNDRVGNPVSRTVAY 238 
34419575   240 QSNTFSYLLGYDYLIQGVSSTDVDYSHDnglEYSHASVDLTFDKLDFDLGFGFDVERFKDLAILPPQVRHKADAFGVDDV 319 
109290119  234 QSSTTTYLLGYENIYYGRRANDARWSAD---DVRFSSDSVTFSKTGDELNLGFNVEIFNSYARLPGDIFRKGEAIAADDD 310 
33620635   240 QSKTTTYVLGYDRIFYGRQASDTRWSAD---DVRFSDDTITFAKVGDENDLGFDVEVFGVFSRLTGDTTKYAEAMACSDD 316 
37651623   234 QTSTTTYVLGYENIYYGRRANDVRWSAD---DVRFSSDTVTFAKTGDELNLGFDVELFNSYARLPGDMYRKAEAIAADDD 310 
66391658   239 QSTNTTYVLGYDRIFYGRTSTDIRWSAD---DVRFSADDITFTKLGNQTGLDFDVDSYNTFAKLPGDVSKYAEAMACSDD 315 
66391944   234 QTSTTTYVLGYENIYYGRRANDVRWSAD---DVRFSSDTVTFAKTGDELNLGFDVELFNSYARLPGDMYRKAEAIAADDD 310 
157311440  240 QSKTTTYVLGYDRIFYGRQASDTRWIAD---DVRFSDDTITFAKVGDENDLGFDVEVFGVFSRLTGDTTKYAEAMACSDD 316 
238695020  240 QSKTTTYVLGYDRIFYGRQARDTRWSAD---DVRFSDDTITFAKVGDENDLGFDVEVFGVFSRLTGDTTKYAEAMACSDD 316 
304373749  239 QSTNTTYVLGYDRIFYGRTSTDIRWSAD---DVRFSADDIIFAKLGNQTGLDFDVDSYNTFAKLPGDVSKYAEAMACSDD 315 
294661583  239 QIANTTYVLGYDRIFYGRTSTDIRWSSD---EVRFSSDDVTFAKLGNQSGLDFDVDSYNTYARLPGGVSKYAEAMACSSD 315 
34419575   320 MTVVTYGNTYVWHNNRIPRIFDNVQSDLYGERIFETvgeldnepvyfearivqndiSRPDFDeNTADVCVKKiqyfddpe 399 
109290119  311 WVYVAARNKLRRIKTSNAPIDNDPGSPTFGEKLFDP--------------------TAFNIT-TNARAVTKK-------- 361 
33620635   317 YLWVGAKDVIRRIRLKNTPVDTVQGSPTFGEKIFDP--------------------DVIRVT-GNDKAVIQK-------- 367 
37651623   311 WIYVAARNNMRRIRTSNAPIETDPGSPNFGEKLFDP--------------------VAYMVT-NDPSAIVKK-------- 361 
66391658   316 WLYVAAKNIVRRIALKQTPIDTDPSSPTFGEKIFDE--------------------TSYTIVpGNDKIVVKK-------- 367 
66391944   311 WIYVAARNNMRRIRTSNAPIETDPGSPNFGEKLFDP--------------------VAYMVT-NDPSAIVKK-------- 361 
157311440  317 YLWVGAKDVIRRIRLKNTPVDTVQGSPTFGEKIFDP--------------------DVIRVT-GNDKAVIQK-------- 367 
238695020  317 YLWVGAKDVIRRIRLKNTPVDTVQGSPTFGEKIFDP--------------------DVIRVT-GNDKAVIQK-------- 367 
304373749  316 WLYVAAKNIVRRIALKQTPIDTDPSSPTFGEKIFDE--------------------TSYTIVpGNDKIVVKK-------- 367 
294661583  316 WLYVAAKNVMRRIALRNTPIDTDPGSPTFGERIFDE--------------------VSYTIVpGNDKIVVKK-------- 367 
34419575   400 qgLDYQDGHMYALVIGEWEHDSNGK-RIGTSDPNEIRGVYRLNRtaimngdivvgySGLSWERVYGNIAEERLLLNersv 478 
109290119  362 --LDTFNGKLYALITGVVTQAGLDPtKPENVVHDPVAGVYEF--------------DGSSWKKVFG-IGEDHAWIS---- 420 
33620635   368 --MDVIDGKLLVFVTGEVKQRYQDPtKPENVVPSDDAGVYLIGS------------DGLSFQRVFGNTPQEREYIQ---- 429 
37651623   362 --MDTFNGKLYALVTGKVKSQWLDPtVPANIVSTDAIGVYMF--------------DGATWTRVFGNTADERRWFS---- 421 
66391658   368 --MDVMDSKLYVLVTGEVKVALQDPtKPENVVPSVDSGVYQWQE------------DTKTFVRLYGNTEEERFFIE---- 429 
66391944   362 --MDTFNGKLYALVTGKVKSQWLDPtVPANIVSTDAIGVYMF--------------DGATWTRVFGNTADERRWFS---- 421 
157311440  368 --MDVIDGKLLVFVTGEVKQRYQDPtKPENVVPSDDAGVYLIGS------------DGLSFQRVFGNTPQEREYIQ---- 429 
238695020  368 --MDVIDGKLLVFVTGEVKQRYQDPtKPENVVPSDDAGVYLIGS------------DGLSFQRVFGNTPQEREYIQ---- 429 
304373749  368 --MDVMDSKLYVLVTGEVKVALQDPtKPENVVPSVDSGVYQWQE------------DTKTFVRLYGNTEEERFFIE---- 429 
294661583  368 --MDVLNDRLYVLVTGEVKTAMMDPtVKANVIPSNDAGVYLWDE------------NAKTFTRVYGKTEDERFYIT---- 429 
34419575   479 isrdnthlivghdltknygeegnpaYDNRQESSGAPGNYHSTLGSNY-GTVDDPYLVADNDe-VDEAVRMFTKPFFTTYV 556 
109290119  421 -------------------------HDYSNMSTNGEEVFVSQINFKYpGTLPDTDLPARYDn-VFEAVKYELAPGYNSDI 474 
33620635   430 -------------------------HGFSNMSTNGDEVFISHYNHHFeSILPDPETAAKYE--LGEAVKYSQEPTYLTDK 482 
37651623   422 -------------------------HEYTNMSTNGDELFISQVNFKFpGTLPDLELPEKNSq-VIEAVKYQLLPGYNSDI 475 
66391658   430 -------------------------HEYTNMSTNGKEIYISVANYKYpGTLPDPELLITNPe-LVAAVKYDLRPGYTASL 483 
66391944   422 -------------------------HEYTNMSTNGDELFISQVNFKFpGTLPDLELPEKNSq-VIEAVKYQLLPGYNSDI 475 
157311440  430 -------------------------HGFSNMSTNGDEVFISHYNHHFeSILPDPETAAKYE--LGEAVKYSQEPTYLTDK 482 
238695020  430 -------------------------HGFSNMSTNGDEVFISHYNHHFeSILPDPETAAKYE--LGEAVKYSQEPTYLTDK 482 
304373749  430 -------------------------HEYTNMSTNGKEIYISVANYKYpGTLPDPELLITNPe-LVAAVKYDLRPGYTASL 483 
294661583  430 -------------------------HEYTNMSTNGDEVYISVGNYKYpGTLPDPDLVEKYPedVHSAVKYDLVPGYTASI 484 
34419575   557 KPMTQIIATK--DGNTWDYKPQDYYGSAHFNWMQRAETRDWKSWANEIMYYKKESIFRHDFADLDDVR----WKETFNEG 630 
109290119  475 PIHMGTFRINa-DDPVWKLGPQQYYNEAAFNWMGRSGTRCWITNNDRVLVVYPKIEYSFSIDNEGTESdkrvNRETYNKG 553 
33620635   483 KIHQTTFRASydDLRIWELGPQAYYNEADYTWMRRNGVRVWITNDNRPLVVYPEVIYTQEVDTSGILDqnrvNREVYDKG 562 
37651623   476 TIHMGTFRINq-DDDVWKLGPQQYYNEAAYTWMARSGTRCWITNDNRALVVYPKIVYSKSIDDAGFADdsrvNKETHNKG 554 
66391658   484 SINFATIRANidDPTVWKFGAQEYYNEANYSWFFRDSVRTWITNDNRPLVVYPKIVYEMVTDTAGPSStlrvNKEVWDRG 563 
66391944   476 TIHMGTFRINq-DDDVWKLGPQQYYNEAAYTRMARSGTRCWITNDNRALVVYPKIVYSKSIDDAGFADdsrvNKETHNKG 554 
157311440  483 KIHQTTFRASydDLRIWELGPQAYYNEADYTWMRRNGVRVWITNDNRPLVVYPEVIYTQEVDTSGILDqnrvNREVYDKG 562 
238695020  483 KIHQTTFRASydDLRIWELGPQAYYNEADYTWMRRNGVRVWITNDNRPLVVYPEVIYTQEVDTSGILDqnrvNREVYDKG 562 
304373749  484 SINFATIRANidDPTVWKFGAQEYYNEANYSWFFRDSVRTWITNDNRPLVVYPKIVYEMVTDTAGPSStlrvNKEVWDRG 563 
294661583  485 SINFATVRANqnDPTVWNFGPQEYYNEANFSWHFRDKVSTWITNDNRPLVVYPETLYTLVTDSASPAStirvNHEVWDKG 564 
34419575   631 EYTFEAPNLSIFGFNGYAAGAIIHsKNDNKVIGYYKFPYRVDITAPIRWSPERRVITASLSNYTPVIIEPPAEDPtTMLD 710 
109290119  554 VVTLHANNVYFTGFKQYANGVLFH-KNTGEIIGYYEFPYRVRNTTSVFWKPANVMMVAELRNQEREVPWTPAPFV-GLKD 631 
33620635   563 TVTCYLNNVKFEGFKQYASGVMFH-KNTGEIIGFYQFNYRVRDQVGVYWKPTNVAFVAELQNQVREVPWVPVHYD-REQD 640 
37651623   555 TITLYANNVRFNGFKRYANGILFH-KNTGEIIGYYEFPYRVRDEAYVFWKPNFVMLVAELRNQERETPWTPAPNY-GLKD 632 
66391658   564 HVTIYINNIKFTGFTKYTNGVLLY-KSSGEIIGFFELSYRARDSLTIFWKPDNTLLIADLIQQEREQPYVPDLSP-GLID 641 
66391944   555 TITLYANNVRFNGFKRYANGILFH-KNTGEIIGYYEFPYRVRDEAYVFWKPNFVMLVAELRNQERETPWTPAPNY-GLKD 632 
157311440  563 TVTCYLNNVKFEGFKQYASGVMFH-KNTGEIIGFYQFNYRVRDQVGVYWKPTNVAFVAELQNQVREVPWVPVHYD-REQD 640 
238695020  563 TVTCYLNNVKFEGFKQYASGVMFH-KNTGEIIGFYQFNYRVRDQVGVYWKPTNVAFVAELQNQVREVPWVPVHYD-REQD 640 
304373749  564 HVTIYINNIKFTGFTKYTNGVLLY-KSSGEIIGFFELSYRARDSLTIFWKPDNTLLIADLIQQEREQPYVPDLSP-GLID 641 
294661583  565 TVTIYLNNIKFTGFTKYTNGVLLY-RSGGRIIGFYELSYRARDELTIFWKPDNTLMVASLVNQERENPYTPDIEP-GLID 642 
34419575   711 PTLTPLIYKMMPENYLDADGFYKQFAKHYLDFISKGDGTAYNNVYNLLNSKNPLDDHYTEYLHKLVYERNRILEPEKRDA 790 
109290119  632 PDLQPLVTKMMPESYLDEDTNFGAFAKYYLQFLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRNIYLDEAKRDS 711 
33620635   641 PDLRPLLNKMTPDSFLLENENFRKFSEYYLQFLSDGSGTYYNKLKNLIKNKYPREQDAYEYLWSEMNKRNIYADKNKRDA 720 
37651623   633 PDLRPLVTKMMPESYLDEDSNFGAFAKYYLQYLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRNIYLDEAKRDS 712 
66391658   642 PDLSHMITRFAPQSYL-DQEYFEKFGEYYLQFVSLGENTYYNKLLNLIRNKYPREKNCVEYLWSEVNRRNIYLDKTKRDQ 720 
66391944   633 PDLRPLVTKMMPESYLDEDSNFGAFAKYYLQYLSDGNGTYYNKLLNLIKNKYPREQYAYEYLWSEVLKRNIYLDEAKRDS 712 
157311440  641 PDLRPLLNKMTPDSFLLENENFRKFSEYYLQFLSDGSGTYYNKLKNLIKNKYPREQDAYEYLWSEMNKRNIYADKNKRDA 720 
238695020  641 PDLRPLLNKMTPDSFLLENENFRKFSEYYLQFLSDGSGTYYNKLKNLIKNKYPREQDAYEYLWSEMNKRNIYADKNKRDA 720 
304373749  642 PDLSHMITRFAPQSYL-DQEYFEKFGEYYLQFVSLGENTYYNKLLNLIRNKYPREKNCVEYLWSEVNRRNIYLDKTKRDQ 720 
294661583  643 PDLSHMITRFAPQSYL-DNQQFEKFGEYYLQYISLGSNSYYNKLLNLIRNKYPREKNNVEYLWSEINRRNIYLDKTKREA 721 
34419575   791 VVKFFLARRADFYSTKGILDSYKFLFKLLYNEDVEVEIESLNTFEYAIVVNSNDVTDDIVGRRIYSGTGNADVTYISRHY 870 
109290119  712 VARFFESRAYDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVVYSTNISQDIVGRTIYTPTGRANVTYVDREY 791 
33620635   721 VVRFFESRKSDFYSTKGVEASYKFLFKLLYNEDVEIEVESQAGLEYDIVVSSTNIDEDIVGRTIYTPTGRANVTYLEREY 800 
37651623   713 VARFFEARSFDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVVYSTNISQDIVGRTIYTPTGRANVTYIEREY 792 
66391658   721 VVRFFESRASDFYSTKGIEASYKFLFKLLYNEDVSVEIESSNTLEYDILVSSTNISQDIVGRTIYTPTARANVTYIERDY 800 
66391944   713 VARFFEARSFDFYSTKGVEQSYKFLFKLLYNEDVEIDIESKHGIEYDIVVYSTNISQDIVGRTIYTPTGRANVTYIEREY 792 
157311440  721 VVRFFESRKSDFYSTKGVEASYKFLFKLLYNEDVEIEVESQAGLEYDIVVSSTNIDEDIVGRTIYTPTGRANVTYLEREY 800 
238695020  721 VVRFFESRKSDFYSTKGVEASYKFLFKLLYNEDVEIEVESQAGLEYDIVVSSTNIDEDIVGRTIYTPTGRANVTYLEREY 800 
304373749  721 VVRFFESRASDFYSTKGIEASYKFLFKLLYNEDVSVEIESSNTLEYDILVSSTNISQDIVGRTIYTPTARANVTYIERDY 800 
294661583  722 VVRFFESRASDFYSTKGIEASYTFLFKLLYNEDVSVEIESSNSLEYDILVSSTNISQDIVGRTIYTPTGRANVTYIEREY 801 
34419575   871 IEGKRYWKLTLNNLIGELNIGDVLSIDGLDFTATAITRVQGERIDYDSNEFLDRSKSYYVMKLRSEMQLSQYKDDVIRFV 950 
109290119  792 VEGQLKWRITIHNMIGKFFEGQQIKSETSSFVGEILVGVRGKELMSDSIDYINRGRSYYTMTIKSTLPASRYTQDVLRFV 871 
33620635   801 EGGRLRWRVTIHNLIGRFEEGQVIKSEKTAFEGMILVGVRGKELLSSSIDYINRSRSQYTMKIKSALPVSRYANDVMRFV 880 
37651623   793 NEGKLRWRITIHNMIGKFFEGQEIKSETTGFKGDVIVGVRGKELLSDSIDYINRGRSYYTMTIKSVLPASRYSQDVLRFV 872 
66391658   801 EDGQLRWSMTLHNVIGNFLEGQVVKSEKTNFTGSILRGVRGKQMANNSIDYFNRGRSYYVMKIRSNLPASRYKDDVLRFV 880 
66391944   793 NEGKLRWRITIHNMIGKFFEGQEIKSETTGFKGDVIVGVRGKELLSDSIDYINRGRSYYTMTIKSVLPASRYSQDVLRFV 872 
157311440  801 EGGRLRWRVTIHNLIGRFEEGQVIKSEKTAFEGMILVGVRGKELLSSSIDYINRSRSQYTMKIKSALPVSRYANDVMRFV 880 
238695020  801 EGGRLRWRVTIHNLIGRFEEGQVIKSEKTAFEGMILVGVRGKELLSSSIDYINRSRSQYTMKIKSALPVSRYANDVMRFV 880 
304373749  801 EDGQLRWSMTLHNVIGNFLEGQVVKSEKTNFTGSILRGVRGKQMANNSIDYFNRGRSYYVMKIRSNLPASRYKDDVLRFV 880 
294661583  802 ENGQLRWSMTLHNAQGNFIEGQVVKSEKTNFTGMVIRGVRGKQMANNSIDYINRGRSYYVMKIRSNLPTSRYKDDVLRFV 881 
34419575   951 HPIGFGFLGITLLTVLINHGISVEHHETIVDSYRLIRYDNGIGLNFTEETSLLDMYEERVYNSF-GELQVKPHPLAlenp 1029
109290119  872 HPVGFGFVGITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPTEQYDRVAKLDVDGNIEHDSItGEALYLVGPNA---- 947 
33620635   881 HPVGFGFIGVTLLTMFINSGLSMKHTETIIQSLKNYKFDSGLPSVYPDRVADLDVDGNIKKDPLtGKALYLTSPTM---- 956 
37651623   873 HPVGFGFVGITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPLEQYDRVAKLDVDGNIETDPVtGEAVYLVGPNA---- 948 
66391658   881 HPVGFGFIGITMLTVFINSGLSMTHSETIIDILRNYRFDSGYPKYWPDRVARLDGNGNQTFDLVtGEALYEPHPKA---- 956 
66391944   873 HPVGFGFVGITLLTMFINSGLSMKHVETIIDNLKTYRWDAGYPLEQYDRVAKLDVDGNIETDPVtGEAVYLVGPNA---- 948 
157311440  881 HPVGFGFIGVTLLTMFINSGLSMKHTETIIQSLKNYKFDSGLPSVYPDRVADLDVDGNIKKDPLtGKALYLTSPLI---- 956 
238695020  881 HPVGFGFIGVTLLTMFINSGLSMRHVETIIQSLKNYKFDSGLPSVYPDRVADLDVDGNIKIDPLtGKPLYLTSPTI---- 956 
304373749  881 HPVGFGFIGITMLTVFINSGLSMTHSETIIDILRNYRFDSGYPKYWPDRVARLDGNGNQTFDLVtGEALYEPHPKA---- 956 
294661583  882 HPVGFGFMGITMLTVFINSGLSMTHNETIIDILRNYRFDSGYPKFWPDRIASMDGNGNQQFDLVtGEPLYTAHPRA---- 957 
34419575  1030 ldhvihdrilntqgvtiteyndywrndrvialdesvaideqryietdtgdindiwgGKQRVLNPNYNptakiqpADANnS 1109
109290119  948 --------------------------------------------------------GEPFVPPPEYD-------TEEA-- 962 
33620635   957 --------------------------------------------------------GEEFPVPPEYD-------QENS-E 972 
37651623   949 --------------------------------------------------------GQPFDVPPEYD-------TEES-- 963 
66391658   957 --------------------------------------------------------GQPFDVPPQYD-------IDEQ-- 971 
66391944   949 --------------------------------------------------------GQPFDVPPEYD-------TEES-- 963 
157311440  957 --------------------------------------------------------GDEFPVPPEYD-------QENS-E 972 
238695020  957 --------------------------------------------------------GEEFPVPPEYD-------QENS-E 972 
304373749  957 --------------------------------------------------------GQPFDVPPQYD-------IDEQ-- 971 
294661583  958 --------------------------------------------------------GEPFDVPPEYD-------VEEK-- 972 
34419575  1110 EQWGMTPYERAPAFMFDWSTGATSISDMYEDTDYRLKDNVGNPYDPETPTQKQIGE 1165
109290119  963 SWLGKLPSERRFNMSPLFDQSAVTFSHFRRLVEKRLKDDAGNPRDQQNPTQVKIDE 1018
33620635   973 LFHGLKASERRFAMSPLFDQSAVTFSMFRELVDKRLKDNIGNPRDPKNPTQRKING 1028
37651623   964 SWHGKLPSERRFKMSPLFDQSAVTFSNFRRLVEQRLKDDAGNPRDPKVPTQVKIDE 1019
66391658   972 PLNGVLPSARRFDQSPLFDSSAVKYSQFRNLVEKRLKDDAGNPRDPNPPTQRKVGK 1027
66391944   964 SWHGKLPSERRFKMSPLFDQSAVTFSNFRRLVEQRLKDDAGNPRDPKVPTQVKIDE 1019
157311440  973 LFHGLKASERRFAMSPLFDQSAVTFSMFRELVDKRLKDNIGNPRDPKNPTQRKING 1028
238695020  973 LFHGLKASERRFAMSPLFDQSAVTFSMFRELVDKRLKDNIGNPRDPKNPTQRKING 1028
304373749  972 PLNGVLPSARRFDQSPLFDSSAVKYSQFRNLVEKRLKDDAGNPRDPNPPTQRKVGK 1027
294661583  973 PLNGVLPSARRFDQSPLFDCSGVKYSQFRNLVDRRLKDDAGNPRDPNPPSQIKVGN 1028
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap