Conserved Protein Domain Family
53

?
PHA02578: 53 
baseplate wedge subunit; Provisional
Statistics
?
PSSM-Id: 177407
View PSSM: PHA02578
Aligned: 19 rows
Threshold Bit Score: 216.884
Threshold Setting Gi: 294661578
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
34419566    1 MIFAIFDKTEYLGVET---------ANIFKNLNYYHKQIIPSFTTIQYKIRGDYRPEQIAYELYGDTSLYWLIMLLNERV 71 
157311435   1 MLFSFFPAIEYNGKMI---------TDIVRNYRAYFNAIISDYNIQTYYIQGSPRPEQVAYEVYGNQQLYWILLMLNDVY 71 
66391941    1 MIFSFFDPISYQGKET---------TDIFKNYRAYFNRVVVKYKPEVYWLSGSPRPEAVAHELYGNQQLYWVLLMLNNTY 71 
66391654    1 MLFSFFPPVDYNGTPT---------TDIFRDYRFYFNRVIRNYKPRTYQLTGSLRPEQLAETLYGNQQYYWVILMLNDNY 71 
37651620    1 MIFSFFDPISYQGKET---------TDIFKNYRAYFNRVVVKYKPEVYWLSGSPRPEAVAHELYGNQQLYWVLLMLNNTY 71 
33620632    1 MLFSFFPAIEYNGKMI---------TDIVRNYRAYFNAIISDYNIQTYYIQGSPRPEQVAYEVYGNQQLYWILLMLNDVY 71 
32453644    1 MLFTFFDPIGYSAKTInknaptipmTDIFRNYKEYFKRVATNYRLQTYYIKGSPRPEELANIIYGNPQLYWVLLMCNDNY 80 
109290116   1 MIFSFFDPIDYQGKST---------TDIFKNYRAYFNRVIVKYKPEVYWINGSTRPEMLAHELYGNQQLYWVLLMRNDVY 71 
238695015   1 MLFSFFPAIEYNGKMI---------TDIVRNYRAYFNAIISDYNIQTYYIQGSPRPEQVAYEVYGNQQLYWILLMLNDVY 71 
294661578   1 --------------------------------------------------------------------------MLNSVY 6  
34419566   72 DPFYDWVQPNESVSENAIYRYQFIgGNEQVHHHVDEQGRWWYDVVEDPENPRNWYNKfdwennapeeGQEDYRELLYHGV 151
157311435  72 DPFHDWITDQETAYESAEQRYANV-GGNQVLYHVDIDGNKYWNLTEYPKGSSNWYDK----------GDIHHRHLQFQGA 140
66391941   72 DPFYDWLTSQDAAYQYAEQQYPV----NQIAYHIDANGEKYWNLVEDPDFPQNWYDK----------GDKARMHVQYVGP 137
66391654   72 DPFYGWITDQETAYQCAVQRYSKV-GGEQVLYHMDGKNNRYYNLVEDPNNPGHWYDK----------GDKDMRYLQYQGT 140
37651620   72 DPFYDWLTSQDAAYQYAEQQYPV----NQIAYHIDANGEKYWNLVEDPDFPQNWYDK----------GDKARMHVQYVGP 137
33620632   72 DPFHDWITDQETAYESAEQRYANV-GGNQVLYHVDIDGNKYWNLTEYPKGSSNWYDK----------GDIHHRHLQFHGA 140
32453644   81 DPYYGWITSQEAAYQASIQKYANA-GGDQILYHINEKREKFYNLVSYPDEPLVWYDK----------GDKARKYPQYKGP 149
109290116  72 DPFYGWITTQDAAYDYAQQQYPE----NKAVYHVDANGEKYWNLVEDPDFPRHWYDA----------GDTSRSHIQYIGA 137
238695015  72 DPFHDWITDQETAYESAEQRYANV-GGNQVLYHVDIDGNKYWNLTEYPKGSSNWYDK----------GDIHHRHLQFHGA 140
294661578   7 DPFYGWISDQEAAYQCAIQRYSEV-GGEQVLYHVDENNNKYYNLVEDPNNPGHWYDK----------GDKPMLYLQYQGV 75 
34419566  152 MIPVSVDEYEFNRNEENRVINVLSRDDVSTYISTFMKLAGV 192
157311435 141 LSAVDTLEDAILRNEERRKIKIIDPTQIKQFINAFIREMEK 181
66391941  138 LRAVDTLEAQVSLNESRRRIMIINPADINAFLSDMIREMEK 178
66391654  141 LVPIDIYEDAVLKNESMRTIKIINPSDIQSFVSDYIKEMEK 181
37651620  138 LRAVDTLEAQVSLNESRRRIMIINPADINAFLSDMIREMEK 178
33620632  141 LSAVDTLEDAILRNEERRKIKIIDPTQIKQFINAFIREMEK 181
32453644  150 LAAVDTYEAAVLDNEKLRKIKIVAKEDINSFITDLIREMEI 190
109290116 138 LRAVDSLEAQSAVNEQKRKILIISEADINSFLNDMIREMEK 178
238695015 141 LSAVDTLEDAILRNEERRKIKIIDPTQIKQFINAFIREMEK 181
294661578  76 LAPVDIYEDAVLQNEAKRTIKIISPSDIQAFLNDFIKEMEK 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap