Conserved Protein Domain Family
3

?
PHA02576: 3 
tail completion and sheath stabilizer protein; Provisional
Statistics
?
PSSM-Id: 177405
View PSSM: PHA02576
Aligned: 19 rows
Threshold Bit Score: 249.612
Threshold Setting Gi: 34419559
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161622580   1 MNGLFNQTNTTNFILEVSDAGMTQAFKLNVQDVTLPGIHIPVSDVPGSTQGIHRAKMPGSTVEFDPLIVNFLVDRELKSW 80 
66391936    1 -MALNNQSNITNFLLDIPASAGIKVALMNVQQASIPGFRIPPTELPLGEQGTARQNIPSTTTEFDPLIVRILLDEDYDAY 79 
66391650    4 TAMILNQISPTNFLLDIPDNDYMKGLKLQVQGVTLPSIKIPITDAPLNP--MIRSKIPGSAMEFDPLTIRFAVDEELRSY 81 
38640119    1 -MIHSNPAHVTNFRLDIPDTGGTVAFEMAVQGLSIPGININPIEIPINP--MTVGKIPGTAVDFEPLNIRVLLDEHLSAY 77 
37651615    1 -MALNNQSNITNFLLDIPASAGIKVALMNVQQASIPGFRIPPTELPLGEQGTARQNIPSTTTEFDPLIVRILLDEDYDAY 79 
32453641    5 TRQIFNQTNITNFVVDIPDSTRTSGFVLNAQTAPLPGVRIPVVETVTGTMGLGRAMRAGTTFEYDPFIVRFIVDEDMTSW 84 
109290110   1 -MALNNQSNITNFTLDIPSSAGIKTMLMNVQSASIPGFRIPPTEMPLNSQGTARQNVPSTTTEFDPLIVRVLLDEDFEAY 79 
228861080   5 LQQIFNQANTTNFVVSIPHSNTTSAFTLNAQSVPIPGIRIPVTDTVTGPFGLGRAQRPGVTFEYDPLIVRFIVDEELKSW 84 
228861460   5 LQQIFNQANTTNFVVSIPHSNTTSAFTLNAQSVPIPGIRIPVTDTVTGPFGLGRAQRPGVTFEYDPLIVRFIVDEELKSW 84 
294661573   3 TEMILNQISPTNFRVDIPDNSYMKGLTLQVQGVTLPSMNLPAVDIPANM--MVRGKVPGSAFEFDPLMIRFVVDEEMRSY 80 
161622580  81 LDVYKWMLSLNNYVTHDSEAWhPKGQPEAITLHILDNNKQKIVMSIHYYGGWPSDLSEIQYSYKEDSDPAIIATATFNFK 160
66391936   80 FEIYRWMLSINDYARQTPTMWgTTSQPPGVTLHVLSNSKHDIVASFNYQGAWPSEIGEIEYSYTEEGDVSAYFTVTFFFK 159
66391650   82 LGVYLWMLGTVDFNTFESIRW--SESQQAMALHILDNSQSKTVATFRFYGAWPSNLGELELMYTNDSDEAVSCMAMFNFA 159
38640119   78 VEVYKWMLSVVDYAKLNSTAQiDGTVPRTLLLHVLDNSKKKIVLTFKFIDAWPSNLGEVEFTYTDESNTPIVLPVQFMYK 157
37651615   80 FEIYRWMLSINDYARQTPTMWgTTSQPPGVTLHVLSNSKHDIVASFNYQGAWPSEIGEIEYSYTEEGDVSAYFTVTFFFK 159
32453641   85 MNMYKWMLSTNNYITGHNTA--HADGPEFVTLHILNNNKTEVVLTANFYKPWISDLSEIEFSYTEDSDPAVTCVATIHYA 162
109290110  80 TEMYRWMLSLNDYARQTPTMWgTVNQPPAITLHVLNNSKRDIIASFNYHGAWPSEIGEIEYSYTEDGDVSVTFTITFFFK 159
228861080  85 IGMYEWMLGTSNYLTGENTA--QKTGPEYITLYILDNSKTEIVMSINFYKPWVSDLSEVEFSYTEDSDPALVCTATIPYT 162
228861460  85 IGMYEWMLGTSNYLTGENTA--QKTGPEYITLYILDNSKTEIVMSINFYKPWVSDLSEVEFSYTEDSDPALVCTATIPYT 162
294661573  81 LGIYIWMLSTNDYNEFNSVAW--DDPKQSFAVHILDNSQMKTIATFRFYGAFPTNLGEVELGYTNDSDEAVTCMATFGFL 158
161622580 161 SFAVEIDGTIVTGRPQID 178
66391936  160 YFEIERKGQLVRPIRG-- 175
66391650  160 YMEIEIDGKVIVPTPRKK 177
38640119  158 SFVIEKDGVEIRPYVAGS 175
37651615  160 YFEIERKGQLVRPIRG-- 175
32453641  163 YMTIEKDGEVIVSQQPRQ 180
109290110 160 YFEIEKDGELIRPLRV-- 175
228861080 163 YFQVEKDGKIIAEV---- 176
228861460 163 YFQVEKDGKIIAEV---- 176
294661573 159 HMEVEIDGKVVTSQKRMS 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap