Conserved Protein Domain Family
a-gt.4

?
PHA02571: a-gt.4 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177400
View PSSM: PHA02571
Aligned: 19 rows
Threshold Bit Score: 112.518
Threshold Setting Gi: 238694920
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38639954    1 MNERIEDVIAEDQReIEEAKEREQAAIKSMVEKKSKKYLAKNRKEIERLRLHAEECLHVCNKDGYIYAIEKLRVLTLQKp 80 
32453553    1 MTTEIIENKEAEDA-VAKMLQEIQKKNEAEARKKSEKILKKNRFELNRLYAHAQEAAIQNNFEAYEYAIKKSRDILRQP- 78 
33620448    1 -----MTYDEQHDQiAVNEVDKVQAELEAKAAKKAEKILRKNSREIARLKRWAEQAIIDDNRDAYIYAIGKLRDIYKQP- 74 
9632699     1 ----MTDKPEINDE-VEKLISSIEEKNRLEAERKANKLLSKNKRELNRLYKHAQIAAENNNFAQYEYAIKKSRDILKQP- 74 
161622558   1 --MQSTDISQLTEEqIEEAQKRLEENNAKEAASQAAKILKKNAREIKRLNTHAQGAVLENNFEAYKYAIIKLRGIYRQP- 77 
157311341   1 -----MTYDEQHDQiAVNEVDKVQAELEAKAAKKAEKILRKNSREIARLKRWAEQAIIDDNRDAYIYAIGKLRDIYKQP- 74 
238695216   1 --MQSTDISQLTEEqIEEAQKRLEENNAKEAASQAAKILKKNAREIKRLNTHAQGAVLENNFEAYKYAIIKLRGIYRQP- 77 
238694920   1 -----MTYDEQHDKiAVNEVDKVQAELEAKAAKKAEKILRKNSREIARLKRWAEQAIIDDNRDAYIYAIGKLRDIYKQP- 74 
228861377   1 ----MTDKPEINDE-VEKLISSIEEKNRLEAERKANKLLSKNKRELNRLYKHAQIAAENNNFAQYEYAIKKSRDILKQP- 74 
228860998   1 ----MTDKPEINDE-VEKLISSIEEKNRLEAERKANKLLSKNKRELNRLYKHAQIAAENNNFAQYEYAIKKSRDILKQP- 74 
38639954   81 IAKDVLESLWMSSKQRYDELVMEAYQKVTE 110
32453553   79 YNDKLIKIQWVTTRQAIEDIINGASSNKV- 107
33620448   75 HTPELLSAMWISTRQTVLSML--------- 95 
9632699    75 YNDELISILWKTTRSQIEDMIDAYTRKIQA 104
161622558  78 TTDEIVRVMWETTRKQIWEIINGASK---- 103
157311341  75 HTPELLSAMWISTRQTVLSML--------- 95 
238695216  78 TTDEIVRVMWETTRKQIWEIINGASK---- 103
238694920  75 HTPELLSAMWVSTRQTVLSML--------- 95 
228861377  75 YNDELISILWKTTRSQIEDMIDAYTRKIQA 104
228860998  75 YNDELISILWKTTRSQIEDMIDAYTRKIQA 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap