Conserved Protein Domain Family
dexA

?
PHA02570: dexA 
exonuclease; Provisional
Statistics
?
PSSM-Id: 177399
View PSSM: PHA02570
Aligned: 19 rows
Threshold Bit Score: 364.003
Threshold Setting Gi: 34419258
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9632733     1 MFDFIIDFETMGSGEKAAVIDLAVIAFDPNPEVVETFDELVSRGIKIKFDLKSQKGHRLFTKSTIEWWKNQSPEA-RKNI 79 
157311308   3 PVDLMIDFESLGYPPDGAVINMAAIGFKEDPHNPPTFKELVDNSFLVKFDIPSQKGVRVFDHGVVEWWKNTASEGmRKQL 82 
66391824    4 VTDFVLDWETMGNAPEGAVVDLAVLVFEHDPHNLPTFEELCRRGRRFKFDLKSQKGKRIFDQGTMDWWKKQSDEA-KLNL 82 
66391472    5 YVDYVWDYETVGPSPNGKIVELSYVPFIDDPHNPPTFEELVSPPVKSINLICVSNQIALQTNQRSDWWKQQSEEA-RVIL 83 
38639932    7 YDDYIIDMETFSNKANATVIDLAAIVYREDIQNPPSFQELVSRGIKIKFDLKSQSN-RHKMKSTIEWWKNQVPEA-KKNL 84 
37651502    4 VTDFVLDWETMGNAPEGAVVDLAVLVFEHDPHNLPTFEELCHRGRRFKFDLKSQKGKRIFDQGTMDWWKKQSDEA-KLNL 82 
33620642    3 PVDLMIDFESLGYPPDGAVINMAAIGFKEDPHNPPTFKELVDNSFLVKFDIPSQKGVRVFDHGVVEWWKNTASEGmRKQL 82 
109290005   4 VTDFIIDWETMGNAPDGAVVDLAVLVFEHDPYKLPTFEDLCKRGRRFKFNLQEQKGMRFFDQGTIDWWKKQDTEA-QKHL 82 
238694886   3 PVDLMIDFESLGYPPDGAVINMAAIGFKEDPHNPPTFKELVDNSFLVKFDIPSQKGVRVFDHGVVEWWKNTASEGmRKQL 82 
294661439   5 PVDFVFDYESIGPFPKGKLAELSYVPFVDDPYDPPTFQELIAKGRKYKFDIRKQPE-RIKDEKTIEWWKQQSKEA-QRVL 82 
9632733    80 APSDEDVSTIDGIAKFNDYINAHN--IDPWKSQGWCRGMSFDFPILVDLIRDIQrlngvseNELDTFKLEPCKFWNQRDI 157
157311308  83 ITNGTEVSTKEGLARFNAFCESVG--VDPVKSVMWSRGNAFDIPLLVDMIRRAH-------NTRETFNLEPVRFWNIRDV 153
66391824   83 KPSDIDVDYLSFYDDFMNFLKAEG--FNKKTGQGWCRGQSFDFPILIDVIRQIH-------GTRETFNLEPCFFWQQRDV 153
66391472   84 KPSPDDIDLYEGHKQFFEDLKADG--VSRWQSLDYVRGPEFDRGILVDVVRKMT-------GKVDIFDDMPTVFWNSRDV 154
38639932   85 KPSMNDVNINVGMEKFFDYIRRPGfkVDYWKSLAWCRGNSFDFAIFEDMLSEYL-------EQDDTIFEQPVNFSRQRDI 157
37651502   83 KPSDIDVDYLSFYDDFMNFLKAEG--FNKKTGQGWCRGQSFDFPILIDVIRQIH-------GTRETFNLEPCFFWQQRDV 153
33620642   83 ITNGTEVSTKEGLARFNAFCEAVG--VDPVKSVLWSRGNAFDIPLLVDMIRRAH-------NTRETFSLEPVRFWNIRDV 153
109290005  83 KPSSEDVSVMEFYESFLDFLAAQG--FDKKTGQGWCRGQSFDFPIMVDVIRKIY-------NTRETFKYEPCFFWQQRDV 153
238694886  83 ITNGTEVSTKEGLARFNAFCEAVG--VDPVKSVMWSRGNAFDIPLLVDMIRRAH-------NTRETFSLEPVRFWNIRDV 153
294661439  83 FPSDIDMDLYEGHRQFFADLAADG--VSRWQSYDYTRGPEFDRSMLTDVVRTMT-------GKLDTFEDMPTVFWNSRDV 153
9632733   158 RTRIEALLLVRDMTTCPLPKGTLDGFVAHDSIHDCAKDILMMKYALRYAMGLEDAPseEECDPLSLPTKR 227
157311308 154 RTAIERTLMHRGMCECPLPMGTLDGFIAHDAIHDCARDILMLIYAQRYAMGLEDLP--ENPDPNSVKKQR 221
66391824  154 RTAVEATLMVRDMTMCPMPKGALDGFVMHDAIHDCAKAALELLYSKRYALGLEEVPtgDDIDPRSVRK-- 221
66391472  155 RTAIENRLLTRGASTCPLRKGILNGFVMHNSIHDCAKDALMLIYAMRYAMGLEEPPteEETDELSFPRKR 224
38639932  158 RTAIEQNLCSRMQTICPLPKGTLDGFVKHDSIHDCAKDILMLIYSKRYAWGLEDMPtgDNVDPLSILRG- 226
37651502  154 RTAVEATLMVRDMTMCPMPKGALDGFVMHDAIHDCAKAALELLYSKRYALGLEEVPtgDDIDPRSVRK-- 221
33620642  154 RTAIERTLMHRGMCECPLPMGTLDGFIAHDAIHDCARDILMLIYAQRYAMGLEDLP--ENPDPNSVKKQR 221
109290005 154 RTAVEATLLMRDMTMCPMPKGVLDGFVAHNAIHDCAKAALELLYSKRYALGLDDIPtgDDVDPRSVRK-- 221
238694886 154 RTAIERTLMHRGMCECPLPMGTLDGFIAHDAIHDCARDILMLIYAQRYAMGLEDLP--ENPDPNSVKKQR 221
294661439 154 RTAIENRLLTRGVTTCPLRKGMLDGFIQHDSIHDCAKDALMLIYAKRYALGLEEPPslEETDENSIGKKR 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap