Conserved Protein Domain Family
39

?
PHA02569: 39 
DNA topoisomerase II large subunit; Provisional
Statistics
?
PSSM-Id: 177398
View PSSM: PHA02569
Aligned: 19 rows
Threshold Bit Score: 931.089
Threshold Setting Gi: 9632631
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33620688    1 MSEFRILSDREHVLKRAGMYIGSTTYEEHQRFLFGKWTKISYVPGLVKIIDEIIDNSVDEAIRTNFEFANVISVDIQ--N 78 
109289993   2 SDEFKVLTPREHVILRPNMYVGSVAYEPHERFLFGKYQSVSYVPGLVKIIDEIIDNSVDEGIRTDFKFANKIDIRFDllE 81 
34419280    4 QDNFQILSDKQHVLKRPGMYIGSVDREAHERFVLGEYKQIEYVPGLVKIINEVIDNSLDEAIRTKFKFANVIEVKVE--G 81 
37651488    2 SDEFKVLTPREHVILRPNMYVGSVAYEPHERFLFGKFQSVSYVPGLVKIIDEIIDNSVDEGIRTDFKFANKIDIRFDllE 81 
66391456   24 VDESFCLSDRDHIRKRPNMYVGSVNREAHERFIMGKFRKVEYVEGLVKIINEILDNSIDEAIRTDFKFANRIEVKID--H 101
66391811    2 SDEFKVLTPREHVILRPNMYVGSVAYEPHERFLFGKFQSVSYVPGLVKIIDEIIDNSVDEGIRTDFKFANKIDIRFDllE 81 
157311305   1 MSEFRILSDREHVLKRAGMYIGSTTYEEHQRFLFGKWTKISYVPGLVKIIDEIIDNSVDEAIRTNFEFANVISVDIQ--N 78 
238694884   1 MSEFRILSDREHVLKRAGMYIGSTTYEEHQRFLFGKWTKISYVPGLVKIIDEIIDNSVDEAIRTNFEFANVISVDIQ--N 78 
304373561  24 VDESFCLSDRDHIRKRPNMYVGSVNREAHERFIQGKFRKVEYVEGLVKIINEILDNSIDEAIRTDFKFANKIEVKID--H 101
294661429  25 VDESFCMSDRDHIRLRPNMYVGSVNKEAHERFIMGQYRKVEYVEGLVKIINEILDNSIDEAIRTEFKHANKIDVTID--H 102
33620688   79 NIVTVTDNGRGIPQHMVTTPEGtQIPQPVAAWTRTKAGSNFDDTNRLTQGMNGVGSSLSNFFSDWFTGVTCDGETEMTVQ 158
109289993  82 GSVTVVDNGRGIPQSMVNTPDG-EMPKPVAAWTQTMAGSNFDDTKRVSMGMNGVGSSLTNFFSKTFIGETCDGKNFLTVT 160
34419280   82 NRITIADNGRGIPQDKVIDPHGnELLRPEAAWTRTKAGSNF-EDDRTTVGMNGVGAALTNYFSHQFIGKTCDGKNTVTVS 160
37651488   82 GSVTVVDNGRGIPQSMVETPDG-EMPKPVAAWTQTMAGSNFDDTNRVSMGMNGVGSSLTNFFSKKFIGETCDGKNFLTVT 160
66391456  102 NLVTISDNGRGIPQDDVRTPEGkIVPKPVAAWTMAKSGSNFDDENRVTMGMNGVGSFLTNCYSSIFIGETSNGKRKVTIN 181
66391811   82 GSVTVVDNGRGIPQSMVETPDG-EMPKPVAAWTQTMAGSNFDDTNRVSMGMNGVGSSLTNFFSKKFIGETCDGKNFLTVT 160
157311305  79 NIVTVTDNGRGIPQHMVTTPEGtQIPQPVAAWTRTKAGSNFDDTNRLTQGMNGVGSSLSNFFSDWFTGVTCDGETEMTVQ 158
238694884  79 NIVTVTDNGRGIPQHMVTTPEGtQIPQPVAAWTRTKAGSNFDDTNRLTQGMNGVGSSLSNFFSDWFTGVTCDGETEMTVQ 158
304373561 102 NLVTISDNGRGIPQDDVRTPEGkIVPKPVAAWTMAKSGSNFDDENRVTMGMNGVGSFLTNCYSSIFIGETSNGKRKVTIN 181
294661429 103 NLVKISDNGRGIPQDDVKTPDGkIVPKPVAAWTMAKSGSNFDDKNRVTMGMNGVGSFLTNCYSSIFIGETANGKRKVTIN 182
33620688  159 CTNGAENITWSSKPSKLKGTNVTFCPDFDHFEGYMMDNSVLDIVHDRLQSLSVIFPKITFKFNGKRIVSKFKDYAKLYND 238
109289993 161 CSDGASQVNWETKPGKIKGTSVYFIPDEKHFEGKTIDQQIVDIISDRITALSVVFPKIKFTINGEVASMKFAEYAKMFGD 240
34419280  161 CSNNAERIFVRTSKGGTQGTSVEFIPDFNRFGVFGISPQDEEIIKDRLAALSVAFPEITFKYNGKKHAPTLKQYAKMFGT 240
37651488  161 CSEGASNIDWETKPGKIKGTSVYFIPDEKHFEGRTIDQQIIDIISDRITALSVVFPQIKFTINGQIASMKFADYAKMFGD 240
66391456  182 CTDGAQNMDYRTSPTKEQGTTVKFTPDFSIFGVDGIDEETKEVIKDRLMALAVAFPSVKFTYNGETLPNKFAMYGAMYGD 261
66391811  161 CSEGASNIDWKTKPGKTKGTSVYFIPDEKHFEGRTIDQQIIDIISDRITALSVVFPQIKFTINGQIASMKFADYAKMFGD 240
157311305 159 CTNGAENITWSSKPSKLKGTKVTFCPDFDHFEGYMMDNSVLDIVHDRLQSLSVIFPKITFKFNGKRIVSKFKDYAKLYND 238
238694884 159 CTNGAENITWSSKPSKLKGTKVTFCPDFDHFEGYMMDNSVLDIVHDRLQSLSVIFPKITFKFNGKRIVSKFKDYAKLYND 238
304373561 182 CTDGAQNMDYRTSPTKEQGTTVKFTPDFSIFGVDGIDEETKEVIKDRLMALAVAFPSVKFTYNNEVLPNKFAMYGAMYGE 261
294661429 183 CTDGAQNIDYRTSPSKEQGTTVKFTPDFSMFGVTGIDEETKEVIKDRLMALAVAFPSVKFTYNGETLSNRFPLYASMYGD 262
33620688  239 DPFVIEDKNFSLALVPAveGEGFKSVSFANGLFTKNGGTHVDYVTDDLCEEIVKRIKKEYKVDVTKAAVKSGLTCILIVR 318
109289993 241 ESLILENDNFSIAICNS--PEGFRQVSYVNGLNIKNGGSHIDYLVDGIADELIPSIKRKHKIEISKARIKECLTMIVAVR 318
34419280  241 D-VSFEFDNVALFIAAS---DEFRHNSFINGVHTINGGTHVDYFSNKLADELIPMIKRKHKINVPKPQLKNGLTIGLFIR 316
37651488  241 ESLIVESDRFSIAICNS--PEGFRQVSYVNGLNIKNGGSHIDYLVDGISEELMPAIKKKHKIEISKARVKECLTMVVVVR 318
66391456  262 STITQTNNKISFILAST--EDGFKQKSFVNGLDTKNGGVHVDCMIDGIYAELEPMIKKKHAIEIPKARVKECLTLVVFLH 339
66391811  241 ESLIVESDRFSIAICNS--PEGFRQVSYVNGLNIKNGGSHIDYLVDGISEELMPAIKKKHKIEISKARVKECLTMVVVVR 318
157311305 239 DPFVIEDKNFSLALVPAveGEGFKSVSFANGLFTKNGGTHVDYVTDDLCEEIVKRIKKEYKVDVTKAAVKSGLTCILIVR 318
238694884 239 DPFVIEDKNFSLALVPAveGEGFKSVSFANGLFTKNGGTHVDYVTDDLCEEIVKRIKKEYKVDVTKAAVKSGLTCILIVR 318
304373561 262 KTIVQTNNKISFILAST--EDGFKQKSFVNGLDTKNGGVHVDCMIDGIYTELEPMIKKKHAIEIPKARVKECLTLVVFLH 339
294661429 263 KTIVQTNNRLSFILAST--EDGFKQKSFVNGLDTKNGGVHVECMIDGIYSELEPMIKKKHSIEIPKARVKECLTLVVFLH 340
33620688  319 ELPNLRFDSQTKERLTNPTGDIKRHI-DLDFKKLAKVIAKKENIIMPIIAVVLARKEAADKAAATKAAKAAKRAKVAKHV 397
109289993 319 GMSNLRFDSQTKERLTNPLGEVKSHI-ELDFKKLGKQIMNNDAILMPIIEAALARHLAAEKAALTKAQKAAAKTKVAKHI 397
34419280  317 NFVDPKFDSQTKERLTSSQGDVSPYLkDISYDKIAKKILADDDIIMPIIEALLAKQHAAEARELARKQKKAQNAKVVDHI 396
37651488  319 GMSNLRFDSQTKERLTNPAGEVKSHF-DLDFKKLSKQIMNTDAILQPIIEAALARHLAAEKAAMTKAQKAAAKTNCAKHI 397
66391456  340 NFNAPAFDSQTKEKLTNTAGEFNNHA-GLNYKKIAKQIMDTSEIITPIIESALIRKQAAEAAAITKAKKKAKKAKIAKHV 418
66391811  319 GMSNLRFDSQTKERLTNPAGEVKSHF-DLDFKKLSKQIMNTDAILQPIIEAALARHLAAEKAAMTKAQKAAAKTNCAKHI 397
157311305 319 ELPNLRFDSQTKERLTNPTGDIKRHI-DLDFKKLAKVIAKKENIIMPIIAVVLARKEAADKAAATKAAKAAKRAKVAKHV 397
238694884 319 ELPNLRFDSQTKERLTNPTGDIKRHI-DLDFKKLAKVIAKKENIIMPIIAVVLARKEAADKAAATKAAKAAKRAKVAKHV 397
304373561 340 NFNAPAFDSQTKEKLTNTAGEFNNHA-GLNYKKIAKQIMDTSEIITPIIESALIRKQAAEAAAITKAKKKAKKAKVAKHV 418
294661429 341 NFNAPAFDSQTKERLANTAGEFNNHA-NLNYKKIAKMIMDTPEIITPIIESALIRKQAAEAAAITKAKKKAKKAKIAKHV 419
33620688  398 KANLIGT-DAETTLFLTEGDSAINYLISVRDQDLHGGFPLRGKTLTTWEQPEAKIVKNAEIFNIMAITGLQFGVDALd-V 475
109289993 398 KAGSWGDiSKETTLFLTEGDSAIGYLLSVRDSELHGGYALRGKVMNTWGMKGSDVLKNRELADICAIMGLDLANPDDveN 477
34419280  397 KATMPG-----GTLFLTEGKSAIGYLIKVRDSKKHGGIPLRGKVLSTWGKRPAKIMENKELCDIMSVLNIQLGNDDIr-D 470
37651488  398 KAGEWGRnDIETTLFLTEGESAIGYLLKVKDENLHGGYALRGKVMNTWGMKGSDVLKNNELSDICAITGLDLANPDDisQ 477
66391456  419 PASGIDTdGVETTLFLTEGDSAVGQFIECRNEETQGAFPLRGKPLNTWGMSFTDILKNKELFELMAILNLHPGDSSE--- 495
66391811  398 KAGEWGRnDIETTLFLTEGESAIGYLLKVKDENLHGGYALRGKVMNTWGMKGSDVLKNNELSDICAITGLDLANPDDisQ 477
157311305 398 KANLIGT-DAETTLFLTEGDSAINYLISVRDQDLHGGFPLRGKTLTTWEQPEAKIVKNAEIFNIMAITGLQFGVDALe-V 475
238694884 398 KANLIGT-DAETTLFLTEGDSAINYLISVRDQDLHGGFPLRGKTLTTWEQPEAKIVKNAEIFNIMAITGLQFGVDALe-V 475
304373561 419 PASGIDTdGVETTLFLTEGDSAVGQFIECRNEETQGAFPLRGKPLNTWGMSNSDILKNKELFELMAILNLHPGDSSE--- 495
294661429 420 PASGIDTpGIETTLFLTEGDSAVGQFIECRNEETQGAFPLRGKPLNTWGMSFTDIIKNKELFELMAILNIHPGDTSG--- 496
33620688  476 MQYKNIAIMTDADTDGIGSIKPSLISFFARWPELFEDGRIRFIKTPIIIAEPKKGDDvrWYYDLEDFENDRDNIKGYNIR 555
109289993 478 RKYKNVAIMTDADPDGQGSIYPCLLAFFSRWPKLYDLGCVRFVKTPVVILSKGKQTK--WFYTITEFDAQKEKYKGWELR 555
34419280  471 MYYHDIGILVDADVDGKGSIFPLLLAFFYNWPELYKQKRIKFVRTPVVIATNKKETK--WFYSIDEYRKAKLS-KTWKIR 547
37651488  478 RKYKNIAIMTDADPDGQGSIYPCLLAFFARWPKLFDEGSVRFVKTPVVILNKGKNTK--WFYTLTEFEKEKKDYKGWDLR 555
66391456  496 MAYDNIGIMVDADVDG-GDILTLLIAFFSRWPELFEKKKIRYIRTPIIIAKIGKDEK--WFYSMDDFVPFRD--KAKEVR 570
66391811  478 RKYKNIAIMTDADPDGQGSIYPCLLAFFARWPKLFDEGSVRFVKTPVVILNKGKNIK--WFYTLTEFEKEKKDYKGWDLR 555
157311305 476 MQYKNIAIMTDADTDGIGSIKPSLISFFARWPELFEDGRIRFIKTPIIIAEPKKGDDvrWYYDLEDFENDRDNIKGYSIR 555
238694884 476 MQYKNIAIMTDADTDGIGSIKPSLISFFARWPELFEDGRIRFIKTPIIIAEPKKGDDvrWYYDLEDFENDRDNIKGYNIR 555
304373561 496 MTYDNIGIMVDADVDG-GDILTLLIAFFSRWPELFAKKKIRYIRTPIIIAKVGREEK--WFYSLDDFTPFRD--KAKEAR 570
294661429 497 MTYDNIGIMVDADVDG-GDILTLLLAFFSRWPSLFAEKRIRYIRTPIVIAKVGREEK--WFYSLDEFAPFRD--KAKDVR 571
33620688  556 YIKGLASLTESDYHRVINDPV-MEIITLPENYKELFDLLYSEDADQRKIWMQS 607
109289993 556 YIKGLGSLREHEYSEVVNNPQ-YDIVDLGPDWEELFEMLLGDEAELRKQWMSQ 607
34419280  548 YIKGLGSLTEKEYKKVINEPV-FDEIVIDD--PSCFELLFGDDTDKRKDWMTQ 597
37651488  556 YIKGLGSLREHEYSDVVNNPN-YDIVDLGDDWEELFEMLLGDDAALRKEWMSQ 607
66391456  571 YIKGLGSLRKSDYDRVLGDQLkYDTIVLGDDYKDVLELCFGEESDPRKDWVDG 623
66391811  556 YIKGLGSLREHEYSEVVNNPN-YDIVDLGDDWEELFEMLLGDDAALRKEWMSQ 607
157311305 556 YIKGLASLTESDYHRVINDPV-MEIITLPENYKELFDLLYSEDADQRKIWMQS 607
238694884 556 YIKGLASLTESDYHRVINDPV-MEIITLPENYKELFDLLYSEDSDMRKAWMAS 607
304373561 571 YIKGLGSLRKEDYDRVLGDQLkYDTIVLGDEYKDVLELCFGDDSDPRKDWVNG 623
294661429 572 YIKGLGSLRKEDYDRVLGDQLkYDVIVLDDEYKEVLELCFGDESDPRKDWVNG 624
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap