Conserved Protein Domain Family
J

?
PHA02568: J 
baseplate assembly protein; Provisional
Statistics
?
PSSM-Id: 164963
View PSSM: PHA02568
Aligned: 13 rows
Threshold Bit Score: 428.759
Threshold Setting Gi: 126010862
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167832356   1 MLIPGQNRLADPAIVEVPPFEQMLATFKAVTIAHVAESDpalSERIRATLESESELFTKLVEVATVMLQTERRHRNEQIK 80 
169936032   1 MAVIDLSRLPPPQIVDVPDFETLLAERKAAFVALYPVDE---QDAVRRTLALESEPVTKLLQESTYREILLRQRINEAAQ 77 
134288737   3 STPIDLSQLPAPDIVDPLDFETLFAERKARLVSLYPPEH---QAEIAATLALESEPVTRVLQENAYREVLLRQLINDKAR 79 
134288785   3 STPIDLSQLPAPDIVDPLDFETLFAERKARLVSLYPPEH---QAEIAATLALESEPVTRVLQENAYREVLLRQLINDKAR 79 
126010862   1 MFIPGQNQLAKPEVVAVPPFEQQLARFKQAVIDHVAKSDaamAAKVEETLQNEAELATKMVEACTVVLQTRIREVNEDAL 80 
145708095   1 MAIIDLSQLPAPAVVETLDYEAILAERKDYFVSLHPADQ---RDAARATLALESEPITKLLQENAYRELVWRQRVNDAAR 77 
41057369    1 MATVDLSQLPVPDVVEELDYETILAERIATLISLYPEDQ---QEAIARTLALESEPIVKLLQENAYREVIWRQRVNEAAR 77 
9630344     1 MPIIDLNQLPAPDVVEELDFESILAERKATLISLYPEDQ---QEAVARTLTLESEPLVKLLEENAYRELIWRQRVNEAAR 77 
17313237    5 FVAIDLSQLPPPHAVEQLDYEQILAERKAYAISLWPEDQ---QAEIAARLALESEPLTKLLEENAYREMLWRQRVNEAAL 81 
30065720    1 MPIIDLNQLPAPDVVEELDFETILAERKATLISLYPEDQ---QEAVARTLTLESEPLVKLLEENAYRELIWRQRVNEAAR 77 
27311200    4 FKLMDLSKVPVPDIITSPDFETKYEELKAILVGFNPD--------YAEVLQLESDPLAGALQTFAYRELVLEAKINDATR 75 
109289956   2 SEIVDLSKLPAPKVLEELDYETLLAERKAKFLSLYPESE---RAVMAARLALESEPITKLLQENCYLQLLERQRINSAAQ 78 
72537703    3 STPIDLSQLPAPDIVDPLDFETLFAERKARLVSLYPPEH---QAEIAATLALESEPVTRVLQENAYREVLLRQLINDKAR 79 
167832356  81 QMLAWWAEGSNLDAKVADLGLQRQTITEGDPNAFPPVPAVKEDDESLRMRHFLAPYSFSVAGPRLAYQFHAMTLSarpqi 160
169936032  78 AVMVAYSMGNDLEQLAANCNVKRLTVVPADNDAVPPVTAVMEDDEALRQRIPAAFEGLSVAGPTGAYEFHARSAD----- 152
134288737  80 GLLLAYARGTTLEHIAALFDVERLVVTAADPEH--GIDAVYEDDDSLRERVQLAPRGFSVAGPEEAYVFHARAAD----- 152
134288785  80 GLLLAYARGTTLEHIAALFDVERLVVTAADPEH--GIDAVYEDDDSLRERVQLAPRGFSVAGPEEAYVFHARSAD----- 152
126010862  81 QMFAYWAEDSNLDAVVSNLGLRRQVLDEGDANAFPPVPATLESNEHLRLRYFLAPYSFSNAGPRLAYKYHAMTLDerptv 160
145708095  78 GVMLAFAEGEDLEQIAANFNVQRLTITPADTTTVPPTPAVMEGDDSLRERAQEAFEGLSVAGPTKAYEQFARSAD----- 152
41057369   78 AVMLAYAIDSDLDNIGANFNVERLVVTPADDTTIPHTPAEMELDADYRLRIQQAFEGLSVAGSVGSYQYHGRSAD----- 152
9630344    78 AVMLACAAGNDLDVIGANYNTTRLTITPADDSTIPPTPAVMESDTDYRLRIQQAFEGLSVAGSVGAYQYHGRSAD----- 152
17313237   82 ANMLASAQGADLDQLAANYNVKRLVIQPGDPSKVPPVPELLESDDSLRERAQMAWEGLSTAGPRNSYIFHARAAD----- 156
30065720   78 AVMLACAAGNDLDVIGANYNTTRLIITPADDSTIPPTPAVMESDTDYRLRIQQAFEGLSVAGSVGAYQYHGRSAD----- 152
27311200   76 ANMLASSKGNDLDGIGARYNVERLVVQEGDELARPPIPRIMEDDDSYRRRIQMAFDGLNTAGSDDAYVFHALSAS----- 150
109289956  79 ATMLAYATGTDLDVIAANFNVERLVVQAEDLTASPPIVEELEPDDDFRQRVQLKIESVSVAGPRKAYTFHALSAN----- 153
72537703   80 GLLLAYARGTTLEHIAALFDVERLVVTAADPEH--GIDAVYEDEDSLRERVQLAPRGFSVAGPEEAYVFHARAAD----- 152
167832356 161 svatpeegvvtvtyrlptgtlaGKVKDAVGKRTAPGQVRVALLSREGDGTPSEALLDEARAHF-----------ARDDVA 229
169936032 153 ----------------------GRVADASATSPAPAEVVLTVLSREGDGTAVKDLLDVVEKAL-----------NSESVR 199
134288737 153 ----------------------GRVLSASARSPEPCVMVVTVLSREGDGTASDALIDIVRAAL-------------EGVR 197
134288785 153 ----------------------GRVLSAAAFSPEPCVMVITILSREGDGTASDELIEIVRKNL-------------EGKR 197
126010862 161 svdapepnkivvtyefgegsmaGQVKDATGLRTAPGEVKVTVLAREGNGTPSDELVAAVTSYF-----------QRDDVA 229
145708095 153 ----------------------GRVADARAISPAGAEVVVSVLSHLNDGAADESLLAAVRTAL-----------SDDDTR 199
41057369  153 ----------------------GRVGDISVISPSPACVTISVLSRENNGVASEELLAIVRNAL-----------NAEDVR 199
9630344   153 ----------------------GRVADISVTSPSPACVTISVLSRENNGVASEDLLAVVRNAL-----------NGEDVR 199
17313237  157 ----------------------GRVGDASAVSPSPAVVVVTVQAAQGNGSAPADLLAIVDAYL-----------NDADRR 203
30065720  153 ----------------------GRVADISVTSPSPACVTISVLSRENNGVASEDLLAVVRNAL-----------NGEDVR 199
27311200  151 ----------------------GKVLDADATSPSPCNMVVTVLSRDGNGTPDNDLLVAVRRYFgltddglapakQTSKVR 208
109289956 154 ----------------------GKIADVSVISPQPAYVTVTLLSRDGNGAVASEIINAAKIAL-----------NDEEVR 200
72537703  153 ----------------------GRVLSASARSPEPCVMVVTVLSREGDGTASDALIDIVRAAL-------------EGVR 197
167832356 230 PATDDVTVTAADIVNWQCRAVIYINR-GPDPSVVHQQAIKNVQRYANEQHRIEGFIERSALGTELHNAGAVRIELEMPAE 308
169936032 200 PVADRLTVRSAEIIPYRVEATIFLYP-GPEAEPVMVAAKASLQRYIASQTRLGRDIRRSAIYAALHVEGVQRVELTSPLE 278
134288737 198 PQTDQVIVQSAQVVPYAIRATLRFFS-GPDRGVALAEASKHTAKFAADMRRIGMEITVDGLHAAMRVAGVQKVLLDSPAG 276
134288785 198 PQTDEVIVQSAKIVRYAIRATLRFFS-GPDRGVALAEARKRTAKFAADMRRIGMEITVDGLHAAMRVAGVQKVLLDSPAG 276
126010862 230 PETDEITVAKATILPYQIRAIAYISK-GPDTQVTKSAAEALLQQYADEQHHLGATIEPSMVYHVLHQAGAKKVDLLEPLA 308
145708095 200 PLGDRLTVQSATIVPYRIRATLYLAS-GPAAEPILDAAGKRADVYRTTRRRIGRDINRSAITAALHVEGVEKLVLHEPAE 278
41057369  200 PVADRVTVQSAEIVNYQINATLYLYP-GPESEPIRAAAEAKLKAYISAQHRLGRDIRKSAIYAALHVEGVQRVELAAPVA 278
9630344   200 PVADRVTVQSAAIVEYQINATLYLYP-GPESEPIRAAAVKKLEAYITAQHRLGRDIRLSAIYAALHVEGVQRVELAAPLA 278
17313237  204 PVADRLTVQSAQVLEYRVDATLYLATiGPESEPILDAARARLTAYVHQRRRLGMEVSESAVHAALHVEGVRKVTLSN-WS 282
30065720  200 PVADRVTVQSAAIVEYQINATLYLYP-GPESEPIRAAAVKKLEAYITAQHRLGRDIRLSAIYAALHVEGVQRVELTAPLA 278
27311200  209 PLGDRVMVVPANVTEYAVVAELTILP-GPAGDVIRQTAEAAVLEYVNDRHKLGYDVTRSGLYAALHRPGVHNVRLISPAA 287
109289956 201 PIADRVTVQGASIVEYEINAVLHLYR-GPEKEPILKAAKANLEAYINQTKRIGRDVTHSGIHAALHVAGVQNVEILQPRT 279
72537703  198 PQTDQVIVQSAQVVPYAIRATLRFFS-GPDRGVALAEARKRTAKFAADMRRIGMEITVDGLHAAMRVAGVQKVLLDSPAG 276
167832356 309 SLAAADFTAPYCTGIEIEVLQL 330
169936032 279 DVVLDKTQAASCTEWSVTNGGT 300
134288737 277 GVPVTHEQAPYCTGIELIDGGV 298
134288785 277 GVPVTHEQAPYCTGIELIDGGV 298
126010862 309 ELAAGLDEAPWCQLIDIEIRTL 330
145708095 279 DIALDLTQAGYCTGVDIVNGGT 300
41057369  279 DIVLDNTQASFCTDYSLVIGGS 300
9630344   279 DIVLNSTQASFCTEYRVVTGGS 300
17313237  283 DIAATPAQAPYCTGITLTLGDE 304
30065720  279 DIVLNSTQASFCTEYRVVTGGS 300
27311200  288 DLVMDNTQAAFCTGVTVTVGGV 309
109289956 280 DLVLTPYQAGYCVNYTLNVEVS 301
72537703  277 GVPVTHEQAPYCTGIELIDGGV 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap