Conserved Protein Domain Family
49

?
PHA02565: 49 
recombination endonuclease VII; Provisional
Statistics
?
PSSM-Id: 177395
View PSSM: PHA02565
Aligned: 19 rows
Threshold Bit Score: 199.583
Threshold Setting Gi: 29366677
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290047   1 MLLNSKSADELKQKLFEEQNKCCKLCGNEFDGPYNKQHLDHDHVLQGPNAGKIRGLLCSRCNLLEGIMKHKFIRSGLKAK 80 
37651547    1 MLLNSKSSDELKQKLFHAQGGCCKLCKNEFDGPYNKQHLDHDHALEGRNAGKVRGLLCARCNMLEGMIKHKFIRSGLRGR 80 
33620467    1 MLLTAKSAKEYKQELFEKQGGICPLCQLPLFEDMSKNHLDHDHDLDGKGQGRVRGLLHSCCNRLEGSLTGDFKRFGVGAL 80 
38639977    1 MILTPKTYDAAKEKLYHAQNGICPLCKRELDKEINKNHLDHDHELNGPQAGRVRGLLCCFCNKFEGMVRHEFMRSGLASR 80 
66391710    4 KRITKKDYPSIKQALFDKQGGCCALCKRPLEGDIEKHHLDHDHALDGENAGRVRGLLCNLCNGTEGIVKHKFNRSGLVSR 83 
66391869    1 MLLNSKSSDELKQKLFHAQGGCCKLCKNEFDGPYNKQHLDHDHALEGRNAGKVRGLLCARCNMLEGMIKHKFIRSGLRGR 80 
157311361   1 MLLTAKSAKEYKQELFEKQGGICPLCQLPLFEDMSKNHLDHDHDLEGKGQGRVRGLLHSCCNRLEGSLTGDFKRFGVGAL 80 
228861014   1 MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKAGKVRGLLCNLCNAAEGQMKHKFNRSGLKGQ 80 
238694942   1 MLLTAKSAKEYKQELFEKQGGICPLCQLPLFEDMSKNHLDHDHDLDGKGQGRVRGLLHSCCNRLEGSLTGDFKRFGVGAL 80 
294661638   4 KRITKKDYPSIKQALFEQQNGLCALCGRPLEGDLEKHHLDHDHALSGSNAGRVRGLLCNLCNGTEGIVKHKFNRSGLVSR 83 
109290047  81 DVDYIQWMRSLLEYVDSDHSKNPIHPNYVSDMTKNFSRKNLSEMKAELRERGFEFDEKDQKAVLVKKFRKQFKKAIQ 157
37651547   81 DVDYIEWMRELIEYVDSDYSDNPVHSQYLGDMVKQFSKKSLPDMRLDMQERGFDYNDKDVKAELIKKFRKQFKKAIQ 157
33620467   81 GADFVVWATNYVNYIKGDYTNNHLHPQYAVDKVKRFSRLTRAEMVAIMDAEGFDYCDADTREEITKKYKKQFIQRLR 157
38639977   81 NVDYITQLKTLIVYLEQDTKENDIHPKLLPDLKKRFARQDKPAMIAELQSNGFAYNDGMTKAELCTVFNKEMPKKMK 157
66391710   84 DVDYIVWLENLLAYLKQDYSENRIHDKFIPDKVKWFSRLTKPDMIAEMVSMGFEYAEKDERKALTAKYRKQLMKATK 160
66391869   81 DVDYIEWMRELIEYVDSDYSDNPVHSQYLGDMVKQFSKKSLPDMRLDMQERGFDYNDKDVKAELIKKFRKQFKKAIQ 157
157311361  81 GADFVVWATNYVNYIKGDYTNNHLHPQYAVDKVKRFSRLTRAEMVAIMDAEGFDYCDADTREEITKKYKKQFIQRLR 157
228861014  81 GVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK 157
238694942  81 GADFVVWATNYVNYIKGDYTNNHLHPQYAVDKVKRFSRLTRAEMVAIMDAEGFDYCDADTREEITKKYKKQFIQRLR 157
294661638  84 DVDYIEWLESLVAYLKRDYSQNRMHDKFIPDKVKWFTRLTKSDMIAEMISMGFEYSETEDRKALAKSYRRQLMKATK 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap