Conserved Protein Domain Family
FI

?
PHA02560: FI 
major tail sheath protein; Provisional
Statistics
?
PSSM-Id: 164955
View PSSM: PHA02560
Aligned: 15 rows
Threshold Bit Score: 489.222
Threshold Setting Gi: 48696949
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
134288804   1 MAANYLHGVETIEKETGSRPVKVVKSAVIGLIGTAPIG-----PVNTPVQSLSDVDAaqFGPQLAG-FTIPQALDAVYDY 74 
169936025   1 MAQDYHHGVRVVEINEGTRPITTVSTAIVGMVCTGDDAdasvfPLNKPVLLTDVLTA--SGKAGES-GTLARSLDAIADQ 77 
167832365   3 EITEFQHNGVSLETNRPPESMGPLGPNVVGLVVAAPDRdp-svPLNVPFRISNPTQAqlLDKVGDEsGTGWRAVIEILKK 81 
145708101   1 MPTDYHHGVRVVELNDGTRPIRTIETAVAGIVCTADDAdaatfPLDTPVLLTNPQAY--IGKAGDK-GTLAHTLDAITDQ 77 
109289960   3 ILDTYLHGVEVVEVNAGGVTISTAATSVIGVVCTGDQAdaetfPLNTPVLITNPLNY--LEKAGST-GTLRRTLNSIGSI 79 
9630349     1 -MSDYHHGVQVLEINEGTRVISTVSTAIVGMVCTASDAdaetfPLNKPVLITNVQSA--ISKAGKK-GTLAASLQAIADQ 76 
17313241    2 AADQYHHGVRVQEINDGTRPIRTIATAIIGLVATAEDAdatafPLDTPVLITNVQAA--IGKAGTS-GTLPASLQAIADQ 78 
30065725    1 -MSDYHHGVQVLEINDGTRVISTVSTAIVGMVCTASDAdaetfPLNKPVLITNVQSA--IAKAGKK-GTLAASLQAIADQ 76 
27311206    1 MAEQYLHGAEVVEIDNGARPIRTAQSGVIGLVGTAPDAdatafPLNTPVLIAGSRRE--AAKLGAG-GTLPQAIDGIFDQ 77 
41057373    1 -MSDFHHGTQVIEINDGTRVISTVATAVVGMVCTASDAdatlfPLNEPVLITNVQSA--IAKAGKK-GTLAASLQAIADQ 76 
134288804  75 GSGTVIVINVLDPAVHksnaasESvtfdaatgraklahpaaanlvlkndsggttytegtdyavdlingvitriktgtipa 154
169936025  78 AKPVTVVVRVAQGETE------AE-------------------------------------------------------- 95 
167832365  82 AAVPIYVVVVEEGDTE------EA-------------------------------------------------------- 99 
145708101  78 TNPLTVVVRVAGGASE------AE-------------------------------------------------------- 95 
109289960  80 VKTPTVIVRVAESDDS------DT-------------------------------------------------------- 97 
9630349    77 SKPVTVVMRVEDGTGDdeetklAQ-------------------------------------------------------- 100
17313241   79 ANAATVVVRVKPGEDE------AA-------------------------------------------------------- 96 
30065725   77 SKPVTVVVRVEDGTGDdeetklAQ-------------------------------------------------------- 100
27311206   78 TGAVVVVIRVDEGVDS------AA-------------------------------------------------------- 95 
41057373   77 SKPVTVVVRVEDGTGDdeeaalAQ-------------------------------------------------------- 100
134288804 155 aataakatydyadptkvTAADIIGAVNAA-GMRTGMKALKDTYNLYGYFSKILIAPAYCTQnSVSVELEAMAVQLGAIAY 233
169936025  96 -----------------TTSNIIGGVTSD-GKKTGMKALLSAQSQLGVKPRILGVPGHDTQ-AVATELLGVAQSLRGFAY 156
167832365 100 -----------------TTANVVGGVDPVsGQPLGIAALAGCAEV----PTIIGAPGFSSEkGVSDALAALARRIYCRFV 158
145708101  96 -----------------TTSNLIGTTNAA-GRYTGMKALLTARNRFGVAPRILAVPGLDSL-PVGTELVTIAQKLRAFAY 156
109289960  98 -----------------LTANIVGT-QEN-GKFTGIKALLTAQSTVFVKPKLLCVPQHDNQ-AVATELLSVAKKLNAFAF 157
9630349   101 -----------------TVSNIIGTTDEN-GQYTGLKAMLAAESVTGVKPRILGVPGLDTK-EVAVALASVCQKLRAFGY 161
17313241   97 -----------------TNSAVIGGVSAD-GKYTGMKALLAAKARLGVVPRILGVPGLDTQ-PVATALIAIAQQLRAFAY 157
30065725  101 -----------------TVSNIIGTTDEN-GQYTGLKALMGAESVTGVKPRILGVPGLDTK-EVAVALASVCQELNAFGY 161
27311206   96 -----------------TQSNVIGKVDADtEQYTGILALLSAENTVKVQPRILIAPGFSNQ-KAVADQLVSVADTAAWLC 157
41057373  101 -----------------TVSNIIGGTDEN-GKYTGIKALLTAQAVTGVKPRILGVPGLDTK-EVAVALASAAIKLRAFAY 161
134288804 234 IDAPIGTTLAQALAGRGpagtinfNTSSDRVRLCYPHVKVYDIATNAERLEPLSSRAAGLRARVDLDKGYWWSSSNQQLV 313
169936025 157 LAANGCKTVEEAIAYRE-------NFSQREGMLIWPDFINFDTVLKADATAYASARALGLRAKIDEQIGWHKTLSNVGVN 229
167832365 159 IDAPDIPVSEMVAFSETlg---geGTGYRRCYVAYQMCEVYSRAAQGNVFVAPSVHAIGCLAAVQP----WQSPGNQGVL 231
145708101 157 LSAYGCQTKEEAVAYRS-------NFGQREAMVMWPDFVGWDTAANAETTLWATARAVGLRAKIDNDTGWHKTLSNVAVG 229
109289960 158 ISDNGATTKEQAYTYRQ-------NFSQREGMMIFGDWKSYNTDKKAYDTDYAVARACALQAYIDKTVGWHKNISNVELD 230
9630349   162 ISAWGCKTISEVKAYRQ-------NFSQRELMVIWPDFLAWDTVTSTTATAYATARALGLRAKIDQEQGWHKTLSNVGVN 234
17313241  158 VSASGCKTKEEATAYRE-------NFAAREAMVIWPDFLTWSTVVNQTVPAPAVAQALGLRARIDQEVGWHKTLSNVAVN 230
30065725  162 ISAWGCKTISEVKAYRQ-------NFSQRELMVIWPDFLAWDTVTSTTATAYATARALGLRAKIDQEQGWHKTLSNVGVN 234
27311206  158 HSGWSNTTDAAAITYRE-------LFGSRRCEVVDPWYKVWDVETSAHIIQPPSARHAGVMAKVHNTLGFWWSNSNQEIL 230
41057373  162 VSAWGCKTISEAMEYRK-------NFSQRELMVIWPDFLAWDTVKNTTATAYATARALGLRAYIDQTVGWHKTLSNVGVQ 234
134288804 314 GVTGVERPLSAMIDDPQSDVNMLNEQGITTVFSSygSGLRLWGNRTAawpTVTHMRNFENVRRTGDVINESLRYFSQQFV 393
169936025 230 GVTGISADVFWDLQDPATDAGLLNKNDVTTLIRK--DGFRFWGSRCL---SDDPLFAFENYTRTAQVLADTMAEAHMWAV 304
167832365 232 -IQGVARHVDYNILDKSTDGDLLNRYGISYYARTslGGFSLIGNRTV-------TGEFISHVGLEDAIGRKIVGASQKAM 303
145708101 230 GVTGLSRDVFWDLQDPATDAGYLNANEVTTLVHR--DGYRFWGSRTC---SADPLFAFENYTRTAQVLADTMAEAHMWAN 304
109289960 231 GVTGITKAVEFDINESSTEANYLNEKGITICLNH--NGFRYWGSRTL---ATDTRWAFQQSVRTAQIIKETIGAGLAWAV 305
9630349   235 GVTGISASVFWDLQESGTDADLLNESGVTTLIRR--DGFRFWGNRTC---SDDPLFLFENYTRTAQVVADTMAEAHMWAV 309
17313241  231 GVTGISADVFWDLQSPSTDANYLNENEVTTLVQE--GGFRFWGSRTC---SDDPLFAFENYTRTAQVLADTIAEAHMWAV 305
30065725  235 GVTGISASVFWDLQKPGTDADLLNEAGVTTLVRR--DGFRFWGNRTC---SDDPLFLFESYTRTAQVLADTMAEAHMWAI 309
27311206  231 GIDGLCRPVDFKLDDPTCRANLLNAKEVTTTIQQ--NGFRVWGDRTC---SADSKWAFKNVVITNDMIADSLVRNHLWAV 305
41057373  235 GVTGISASVFWDLQASGTDADLLNEAGVTTLVRK--DGFRFWGNRTC---SDDPLFLFENYTRTAQVLADTMAEAHMWAV 309
134288804 394 DAPIDQGLIDSLVESVNGFGRKLIG--DGALLGFKAWFDPARNPKEELAAGHLLINYKYTVPPPLERLTYETEITSEYLL 471
169936025 305 DGVLNPSLARDIIEGLRAKMRSLVN--QGYLIGGDCWLDESVNDKDTLKAGKLTIDYDYTPVPPLENLMLRQRITDRYLV 382
167832365 304 AQNLTKSFMEQEVRKVDAFVQDQVA--AEIIPGGRVYLHPDLNTVERYKNGSWYIVIEYGRYSPNEHMIFHINAVDSIVE 381
145708101 305 DLPMTPTLVRDLLEGINAKLRMLTR--NGYLLGGAAWFDADANSKDTLKAGQLAIDYDYTPVPPLENLTFRQRITDRYLM 382
109289960 306 DMPLTPLRVKTMLEAINNKLRSWASgdDPRILGARVWVAEEI-TADIIKSGKFVIKYDYHWIPSLESLGLEQRVNDEYVV 384
9630349   310 DKPITATLIRDIVDGINAKFRELKT--NGYIVDATCWFSEESNDAETLKAGKLYIDYDYTPVPPLENLTLRQRITDKYLA 387
17313241  306 DKPMHPSLVRDILEGVNAKFRELKG--LGLIIDAQAWYDPNVNDKDTLKAGKLRITYDYTPVPPLEDLTFFQKITDSYLV 383
30065725  310 DKPITATLIRDIIDGINAKFRELKN--NGYIVDGTCWFSEESNDAETLKAGKLYIDYDYTPVPPLENLTLRQRITSRYLA 387
27311206  306 DRNITKTYVEDVTEGVNNYLRHLKN--IGAIAGGECWVDPELNSPDQIQQGKVYFDYDFSAYAPAEHITFRSHMVNGYLT 383
41057373  310 DKPITATLIRDIVDGINAKFRELKS--NGYIVEGKCWFDEESNDKETLKAGKLYIDYDYTPVPPLESLTLRQRITDKYLV 387
134288804 472 TLKGGN 477
169936025 383 DFASRV 388
167832365 382 EFLEEV 387
145708101 383 QFAEAV 388
109289960 385 DLVNTL 390
9630349   388 NLVTSV 393
17313241  384 DFASRV 389
30065725  388 SLVTSV 393
27311206  384 EVV--- 386
41057373  388 NLAESV 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap