Conserved Protein Domain Family
13

?
PHA02554: 13 
neck protein; Provisional
Statistics
?
PSSM-Id: 177388
View PSSM: PHA02554
Aligned: 24 rows
Threshold Bit Score: 303.601
Threshold Setting Gi: 61805992
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161622595   1 MASESYNPKQLKDAILRRLGAPITNIEVTTDQVYDCIQRALELYGEYHYNGYNKGYQAFYIGhddEEKFRNGVFDLKGRN 80 
113200738   2 SATRPASKTELKNYALRRLGYPAIDINVCDEQLDDLVEEAIDYFQEYHYNGSYQSMMKIEVT------------------ 63 
34419583    2 QAYNATSPREMKDLILRRLGAPIVNVEVSEDQVYDCISRALELYIEYHPDGVNKTYSIISLS---EEQAQTGIIDLDIPA 78 
38640144    3 SNNFVRNPRELKDLILRRLGAPVIQVEVTEDHIYDSIGRALELYKEYHHDGLNKAYLSVKLN---QEQAATGYIDISAYP 79 
58532904    1 -MAKPSSKQELIDYCKRQLGAPVLQINTDSAQDDDIIDQAIQYYHEYHFDGIERMYLKHQFTaddVTR------------ 67 
66391951    1 MSYTCNNPLELKDAILRRLGAPIVHVEVTEEQVFDCISRALELYGEYHYDGFHRTYATVVLT---EQQAKTGIIDMKGGN 77 
66391665    1 --MITNNPEQLKDEILRRLGAPIIKIEITQDQIYDCIQRALDLYAEYHYNGTNKSYIILTLG----EDNPRNVFDLSKEH 74 
61806290    2 SATRPASKTELKDYALRRLGFPTIDINVATEQLDDLVEEAIDYYQEYHYNGSFQTFMRIEVT------------------ 63 
255929051   1 -MASPSSRADLITYCKRQLGEPVLQVNIDDEQVNNVIDDTIQFFQENCYNGMERAYLRHKINaddLTRFDGE-------- 71 
294661592   1 --MITNNPAQLKDEILRRLGAPIVKIEVTTDQVYDCIQRALDLYAEYHYNGSNKGYIILTLG----PDNPKNIFDLSKEH 74 
161622595  81 IFAVTQILRTNVGSLTSMDGQATYPWF--------TDFVLGLAGINGGLGSSCNS-FGPNAFGADLGYFTQLMQYRSMMQ 151
113200738  64 -----DAIKTAAQSTTQQGSTN---WYennnyvslPPGVLGVNHVYTNIG--ASSvVPGNIFN---------IKYQIFLN 124
34419583   79 T-AITKILRAE-SSFFTMDGNATYSWF--------SDFLQGLAGGPGA--GSCNSyHQGMLGQGSLSDYWNLMSYKNMLT 146
38640144   80 VFAITKIIRHKSMMWGGLGGGATLNFF--------TDFLTTLGGGPQGI-----SyHGPFGALGNIGFFAQFQSYQNMMM 146
58532904   68 --FTSSDQLTTAPNNDDWENRNNYIQV--------PDAVIGISKVFG----VSSNfLRNNLFGLSNQYY---------LM 124
66391951   78 VFAVTQVLRTNVGSIITMDGTAVYPWF--------TDFVMGMTGASIG---GQCKwYGPNAFGGDLGYFTQLMSYRSMMG 146
66391665   75 IFAVTKVLRTNIGSLVSMDGTAVYPWF--------TDFLMGLTGGSLG-GRCASSvYGMNAYGADLGYFTQMMSYQRSMQ 145
61806290   64 -----EAIKTQAKGFTQEGST---PWYgqdnyvstPPGTLGINHVYTNIG--ASSiVPGNIFN---------IKYQIFLN 124
255929051  72 --------DTTASGTTDWEEATNYIPI--------PDHVVGVTRVFGLVSNSIRS----NLFG---------VEYQLFLN 122
294661592  75 IFAITKVLRTNMGSLVSMDGTAVYPWF--------TDFLMGLTGGSLGGGGCASRtYGMNAYGADMGYFTQMMSYQRSMQ 146
161622595 152 DLLV----PLPDYWYNDATEQLKVMGNFVKGDFIVIEVYTRSFNGVDSM-VGNTAGYGYASGgcDENEWSPGAIWDNPAR 226
113200738 125 DIYAmthgQILHYFMTS------------------------QYLETLDW-VTNSQANRRVKFneHQARLYLDFDWDTLQA 179
34419583  147 DLLS----PEYDYWYNGVNKQLRINANLSAGELIVVEAFVPSALLVSES-ATGIIGNKAATIg-SYEDTTAQERWDDPYS 220
38640144  147 DQLD----PLPDYWLDPVNGVVQLTGNFRENDVIIMEVHIQNFVELEKS-VRGVAGAGIVAG--GPTSADNKDKWMNPYS 219
58532904  125 DLFS------------FSTGSAFSFGNFDLTNYYMIKQHFETIDMIINT--GSLIEYRFNK---RQDRLYIDIDTSRIVE 187
66391951  147 DLLS----PLPDFYYNSSSEMMKIAGQFKAGDLIVFEVYCKSYANVDTMlAGTSAGYGFAMSc-DGDEPSQSQLYGNP-- 219
66391665  146 ELLA----PLPDYWYNDDTGQFCVWGKVNNGDIIVIEVMVRSFVDVPSA-VGSVAGYATAGSn-AVEDQSIADIYDNPYN 219
61806290  125 DIYSmthgQILHYFLTS------------------------QYLETLDF-VTNSQANRRVKWneHSNRLYLDFDWDDLTV 179
255929051 123 DLYAfgslDILNYYMN------------------------KQYLETLDM-VLNNGSFQQFRYtmRRDRLYLDINKAFLKE 177
294661592 147 DLLS----PLPDYWYNDDTGQFAVYGTVKDGDIVVIEAMIRSFVDVPSM-VGNVSGYATAGSd-GEDKPTIADIYNNPYK 220
161622595 227 RISGMRA---GEDLGLQDGAYNNRWVKDYATALVKEVNGNILAKHQGMQLAGGTTVDGIRLIEEARLEKERLREELDLLD 303
113200738 180 GDFIMVDltmRQDPDEYTGMYNDAWLKDYVEALFQQQWGRNLSKYDGIQMLGGVTLNGRQILEDASQFKKDLEENIRKEY 259
34419583  221 ILRQNNTi-gNPNQFAEQNAYSVRWVKDMATAMTKQMNGVILKKHQGLQLPGGITIDGKEIYDEATQEIERLREELMSLT 299
38640144  220 RMPSNVAg-rARSEFPDQGVYNVRWVKDYATTLTKEVWGEILAKHQGMSLPGGVTVDGTRLVEEARQEKEVLRQELLLLE 298
58532904  188 DQYLLIDcyrYLNPDDFTQVYDDSFVKRYATALLKRQWGQNLIKYNSVQLPGGITLNGRQIWEDGNNEVRELESRMMTDY 267
66391951  220 NLAGGAIyagGSNGMLKDGAYNNRWVKDMSTAYVKELNGQVLAKHQGMQLPGGITIDGVRLIEEARIDIDKLRNELELLD 299
66391665  220 AVVGGVRagqGTTVTGGTSAYNNRWVKDYSTALVKEINGQILAKFQGMQLPGGVAPDGTRLIQEAETKLQGLRDELISMS 299
61806290  180 GDYIMVDmtmRQDPTTFTDMFNDNWLKDYVEALFQQQWGRNLSKYDGIQMLGGVTLNGRQILEDASKFKEDLEKDIRDRY 259
255929051 178 DTWLLIEahrLIDPNDATEMYNDMFVKRYATSLMKKQWGQNLIKFNNVQLPGGITLNGRELYTDALAEIEKIESEVLSKY 257
294661592 221 AVSGGVKagqGTSVQGSSSAYNNRWVKDYATALVKEVNGQVLAKFQGMQLPGGVAPDGTRLIQEAMQEKENLRQELLLLS 300
161622595 304 PPTPI-LIG 311
113200738 260 ELPPMdLIG 268
34419583  300 VPLGV-FMG 307
38640144  299 EPLPI-LMG 306
58532904  268 SLPPMdMIG 276
66391951  300 APPPI-IMG 307
66391665  300 DAVPI-IMV 307
61806290  260 EIPPLdLIG 268
255929051 258 AIPPMdMIG 266
294661592 301 DALPV-LMM 308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap