Conserved Protein Domain Family
19

?
PHA02551: 19 
tail tube protein; Provisional
Statistics
?
PSSM-Id: 177385
View PSSM: PHA02551
Aligned: 24 rows
Threshold Bit Score: 246.109
Threshold Setting Gi: 61806002
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
61806305    4 KGTIDQFKANVK-SDFARPNLFQVDLAFPSeilqdsdlvNLGKFTVRAANLPSSQIGVIEVPFRGRVLKIAGDRTFEPWT 82 
61806002   11 LRTISNFKSKLT-GGGARANLFEVVLTFPDvaqpdsavlDKARFLVKGANLPASNVAQIEVPFRGRVLKIAGDRTFDSWT 89 
58532914    1 -MATRLSNFIDMvGQGVKPNMFMVDIVFPNevpgasgdaDMINLLCKSAALPASNLGVIEVPFRGRTVKIAGDRTFDTWT 79 
38640151    1 MELTDISRAYSN-GDFARPNLFEVEIPFMG---------KDFKFKCKGASMPPGVVEPVPVSYQNKKMKLAGDRTFEDWT 70 
34419590    3 LNVDNIKRAFSN-GDFARPNLFEVEIPYLG---------QNFKFQCRASSMPPGSVEKVEVSYQNRKYNIAGDRTFDDWN 72 
33620609    3 LDLNDITRGFES-GDFARPNLFEVEIPYLG---------QNFKLMCKAATVPAATVEKIAIGYQNRKINIAGDRVYDDWT 72 
113200634   5 RGNIDRFKAKVK-KDFARPNLFEVELNFPGaiakgagaaRLGAFTVRAANLPSSQIGVVEVPFRGRVLKIAGDRTFEPWT 83 
109290132   1 MDVTDVLRAFES-GDFARPNLFEIEIPYLG---------QNFKFKAKAGTMPAATVEKIPVGYMNRKLNVAGDRIFDDWT 70 
157311457   3 LDLNDITRGFES-GDFARPNLFEVEIPYLG---------QNFKLMCKAATVPAATVEKIAIGYQNRKINIAGDRVYDDWT 72 
238695037   3 LDLNDITRGFES-GDFARPNLFEVEIPYLG---------QNFKLMCKAATVPAATVEKIAVGYQNRKINIAGDRVYDDWT 72 
61806305   83 ITIMNDSQF-KLRSAMELWASSIQAYNEN----FTSagslgdnSDSSGYFADMTVHQLARDLKdgespkILKSYKFYNIF 157
61806002   90 VTVINDTDF-AIRSAFERWSNTINRLSDN----TGL-------TNPADYQSDAYVYQLDRDGS------TLRSYRFYDTF 151
58532914   80 ATFVNDKEM-KIRGYFEQWLEQINTHETNnaplFTP-------SLDSGYARNLKVKQLEKNGSes--geVLREYVLYYGF 149
38640151   71 ITVYNDEAH-NTRQQFIEWQNLAQALDRN----ILG-------EAPASYKKEATVRQLDRKGK------QTRQYTVYGAW 132
34419590   73 VTVYNDETH-DIRKAIMAWQARAVGLGKD----ISG-------ETPDQYKRTGTITQLDRNGD------PTTSATVYGIF 134
33620609   73 ITVFNDDAH-KIRDAIVAWSDQTHGTGSA----ITG-------ATPAQYKKQAIVRQLNRNTE------STSEKTLYGIF 134
113200634  84 ITVMNDSSF-RLRKIFEKWAQKIQAYNEN----FTAagtlgnaDDSAGYFADMYVHQLSRDIRdgrkpqPLRSYKFIDVF 158
109290132  71 ITIYTDSAPiTLDRQLSDWNAMTHGMGNE----ITG-------DIPEAYKKPGIVRQKDRNGN------TTKEYTIVGLF 133
157311457  73 ITVFNDDAH-KIRDAIVAWSDQTHGTGSA----ITG-------ATPAQYKKQAIVRQLNRNTE------STSEKTLYGIF 134
238695037  73 ITVFNDDAH-KIRDAIVAWSDQTHGTGSA----ITG-------ATPAQYKKQAIVRQLNRNTE------STSEKTLYGIF 134
61806305  158 PSNIAAIDLDYGNNDaVEEFTVEMQVQYWK 187
61806002  152 PTQVGPIELSYDAQG-IQEFTVELQVQYWE 180
58532914  150 PTNVSQIDVAYDSNDqIEEFTVEFQYSYWK 179
38640151  133 PTNIAEIALSWDQNNeVETFEVTLSIDWWQ 162
34419590  135 PTVVGEVALDWDSNNeIETFEVTFSLDYFT 164
33620609  135 PTNVGEVTLDWEQNNeVETFEVTFAIDWVE 164
113200634 159 PSNISSIDLDFGSNDaIEEFTVELQVQYWK 188
109290132 134 PTNVGEVTLDWDDNNtVSTFETTFALDWWE 163
157311457 135 PTNVGEVTLDWEQNNeVETFEVTFAIDWVE 164
238695037 135 PTNVGEVTLDWEQNNeVETFEVTFAIDWVE 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap