Conserved Protein Domain Family
24

?
PHA02548: 24 
capsid vertex protein; Provisional
Statistics
?
PSSM-Id: 177383
View PSSM: PHA02548
Aligned: 21 rows
Threshold Bit Score: 561.277
Threshold Setting Gi: 38640158
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391679    5 HYTIHKLMRQStlpsgkrekvineatgTTDINVQNTRPELVSLTRAVNNLIYHELVAVQETDLPVATLFGVRYRNPNGDM 84 
66391966    1 MSRITDLINES----------------TTTAANSQSRPALAGLTRAVNNLIFTEMVAIQETNMPSSTLYGVKYLNPAGNQ 64 
33620669    2 THIFTELLRES----------------TSSVANQTARPQLLSLTRAVNNLIFSDLVAIQPTDQPVSALYGLRYLNRDGQM 65 
37651645    1 MSRITDLINES----------------TTTAANSQSRPALAGLTRAVNNLIFTEMVAIQETNMPSSTLYGVKYLNPAGNQ 64 
9632598     1 MAKINELLRES----------------TTTNSNSIGRPNLVALTRATTKLIYSDIVATQRTNQPVAAFYGIKYLNPDNEF 64 
109290141   1 MSRINDLISES----------------TTTGANSQSRPALVGLTRAANNLIFTEMVAIQETNMPTSTLYGVKYLNPAGNQ 64 
157311466   2 THIFTELLRES----------------TSSVANQTARPQLLSLTRAVNNLIFSDLVAIQPTDQPVSALYGLRYLNHDGQM 65 
238695046   2 THIFTELLRES----------------TSSVANQTARPQLLSLTRAVNNLIFSDLVAIQPTDQPVSALYGLRYLNRDGQM 65 
304373771   5 HYTIHKLMRQSalpsgkrekvineatgTTDINVQNTRPELVSLTRAVNNLIYHELVAVQETDLPVATLFGVRYRNPNGDM 84 
294661609   5 FYTINKLVRQSqlppglskkvldeatgTETINVANTRPDLVSLTRAVNNLIYGELVAIQETNLPTATLFGVRYRNPKGDM 84 
66391679   85 TFSSAATYSGRISGRTGIDDIDLAK----AYVKGDLFKHDvtDVVYEVIAPITLNT-LDTDKDTALMKGVFQSKIRLVSE 159
66391966   65 SFASAATYMGDVGYRDGIPLAVLNS----PMTEGFVFKDSl-DVVYTVIKPLTLMS-ATSDVNDAINDAVLLGDIRIKSE 138
33620669   66 TFRTAATYGGAAGDRTEIEEFSKEK----SYDEGALFKSG--DVVYEVVTAGTVGE-DAETPESAIFKGVMTNKIRFYSD 138
37651645   65 SFASAATYMGDVGYRDGIPLAVLNS----PMTEGFVFKDSl-DVVYTVIKPLTLMS-ATSDVNDAINDAVLLGDIRIKSE 138
9632598    65 TFKTGATYAGEAGYVDREQITELTEesklTLNKGDLFKYN--NIVYKVLEDTPFATiEESDLELALQIAIVLLKVRLFSD 142
109290141  65 SFASAATYMGSVGYRDSIPLAQLDT----PMVKGYVFKDSn-DVVYSVTNPLTLTS-STGNIADAIGDAVMLGNLRIKSE 138
157311466  66 TFRTAATYGGAVGDRTEIEEFSKEK----SYDEGALFKSG--DVVYEVVTAGTVGE-DAATPEAAIFKGVMTNKIRFYSD 138
238695046  66 TFRTATTYGGAAGDRTEIEEFSKEK----SYDEGALFKSD--NVVYEVVTAGTVGA-DAETPEAAIFKGIMTNKIRFYSD 138
304373771  85 TFSSAATYSGRISGRTDIDDIDLAK----AYVKGDLFKHDvtDVVYEVIEPVKLNA-LDTDKDTAIMKAVFQSKIRLVSE 159
294661609  85 TFSSAATYSGKYASRDNISNGAVGT----AYTKGQVFKHPtsDVVYEVTDSVTLAG---ADINEAIMVALFSNKLRLASE 157
66391679  160 AADTSKYE-TSEDIASTSFQMDRWNIPVRSRKFKTEMTVELIQDLEANQFEADGVIEDILGTVASEEVNKDIIQTLITVS 238
66391966  139 AALAEKFE-GAESFVETDFQFDRWTVPVRSRKLKTNISVELLQDLEANKLDAVGIIDDVLSTMISEDINKDIIQSMVTVS 217
33620669  139 CASVEYFEdKNTEISSTSMQFDKWQVNVGSRKLKTSFTTELMQDLEASQINSENSVIDLLATVASEEINKDIIQKLITVS 218
37651645  139 AALAEKFE-GAESFVETDFQFDRWTVPVRSRKLKTNISVELLQDLEANKLDAVGIIDDVLSTMISEDINKDIIQSMVTVS 217
9632598   143 AASTSKFEsSDSEIADARFQINKWQTAVKSRKLKTGITVELAQDLEANGFDAPNFLEDLLATEMADEINKDILQSLITVS 222
109290141 139 AALAEEFE-GASSFVETDFKFDRWTVPVRTRKLKTNISVELMQDLEANKMDGVGVVDDVLSTMISEDINKDIIQTLITVS 217
157311466 139 CASVEYFEdKNTEIASTSMQFDKWQVNVGSRKLKTSFTTELMQDLEASQINSENSVIDLLATVASEEINKDIIQKLITVS 218
238695046 139 CASVEYFEdKNTEISSTSMQFDKWQVNVGSRKLKTSFTTELMQDLEASQINSENSVIDLLATIASEEINKDIIQKLITVS 218
304373771 160 AADTSKYE-TSEDIASTSFQMDRWNIPVRSRKFKTEMTVELMQDLEANQFEADGVIEDILGTVASEEVNKDIIQTLITVS 238
294661609 158 AAPTSQYE-TSEDISTTSFEMDRWNINVRSRKFKTEMTVELMQDLEANQFNAENVIEDVLGTVASEEVNKDIIQTLINVS 236
66391679  239 KRYNVNGVVTDGIFdatTSYTAADAPALGRMLYQLACEMGQEMNKTTSFDATYVLCSARVTGILAASGWMTETDeqHPL- 317
66391966  218 RRYKVEGISPNGII---DLTSSIDAPIIGRTLYQQACEMKNQMLRNTSYEATYVLCTTRVSAMLEASGWMEAND--DPL- 291
33620669  219 SRYKIKGITPDGVL---SLVSVQDAPTQARELYRYACEMSNQMLRTSSFAGTYVLASSRVVGLLQSSGWMEETD--NAL- 292
37651645  218 RRYKVEGISPNGII---DLTSSIDAPIIGRTLYQQACEMKNQMLRNTSYEATYVLCTTRVSAMLEASGWMEAND--DPL- 291
9632598   223 KRYKVTGITDSGFI---DL-SYASAPEAGRSLYRMVCEMVSHIQKESTYTATFCVASARAAAILAASGWLKHKPedDKYl 298
109290141 218 RRYKVEEISPNGIL---DLTTSTDAPVIGRTLYQQACEMKNQMLRNTSYEATYVLCQTRVSAMLEASGWMYANE--DPL- 291
157311466 219 SRYKIKGITPDGVL---SLVSVQDAPTQARELYRYACEMSNQMLRTSSFAGTYVLASSRVVGLLQSSGWMEETD--NAL- 292
238695046 219 SRYKIKGITPDGVL---SLVSVQDAPAQARELYRYACEMSNQMLRTSSFSGTYVLASSRVVGLLQSTGWMEETD--NAL- 292
304373771 239 KRYNVDGVVVDGIFdgtTTYTAKDAPALGRILYQLACEMGQEMNRTTSFDATYVLASARVVGVLAASGWMTETDeqHPL- 317
294661609 237 NRYNVDGVVTNGIFdatTAYTAKDAPALGRFLYQLVCEMGQEMNRTTSFEATYVLASSRVVSVLSASGWMHETDetHPL- 315
66391679  318 ---ATGKLQNGYYVYTDTNTPFDYLLTGCKYDLGDMDHVGSLFFTPYTEAD------EAGSIKVSVDPASLQPKVAILMR 388
66391966  292 ---SAGTLKNGLLVFVDTVSSFDYLITGCKHNVNDIEHVGSLFYSPFIEAD------DLGAYKIINDPSSLQPAVGILIR 362
33620669  293 ---SEGRLRCGLEVYADTTTPFDYMLVGCKHMIGDMESVGSLFYSPYTEAD------GAGAYKSVIDPNSFQHHVAIMNR 363
37651645  292 ---SAGTLKNGLLVFVDTVSSFDYLITGCKHNVNDIEHVGSLFYSPFIEAD------DLGAYKIINDPSSLQPAVGILIR 362
9632598   299 sqnAYGFLANGLPLYCDTNSPLDYVIVGVVENIGEKEIVGSIFYAPYTEGLdlddpeHVGAFKVVVDPESLQPSIGLLVR 378
109290141 292 ---SAGTLRNGLKVYVDTVSSFDYLITGCKHYVNDIEHVGSLFYSPYIEAD------DLGAYKIINDSTSLQPSVGIMLR 362
157311466 293 ---SEGRLRCGLEVYADTTTPFDYMLVGCKHMIGDMESVGSLFYSPYTEAD------GAGAYKSVIDPNSFQHHVAIMNR 363
238695046 293 ---SEGRLRCGLEVYADTTAPFDYMLVGCKHMIGDMESVGSLFYSPYTEAD------GAGAYKSVIDPNSFQHHVAIMNR 363
304373771 318 ---ATGKLQNGYYVYTDTNTPFDYLLTGCKYDLGDMDHVGSLFFTPYTEAD------DAGSIKVSVDPASLQPKVAILMR 388
294661609 316 ---ATGRLKNGYYVYTDTNTPFDYLLTGCKYDLGEMDHVGSLFYTPYTEAD------QAGSIKISVDPQSLQPKVAILMR 386
66391679  389 YGLSVNPYTTETDSD--RLIKGDDWSNLAGKSKLSQIVGVKLPTWVNH 434
66391966  363 YGLSVNPYTTSIGRNgdRDVVGDDWSKLAGESDMSYLLGVKLPKIMPV 410
33620669  364 YSLSVNPYTSKVDQEehQVIKGDDWGKMAGRSEMSYILGIELPPLEID 411
37651645  363 YGLSVNPYTTSIGRNgdRDVVGDDWSKLAGESDMSYLLGVKLPKIMPV 410
9632598   379 YALSANPYTVAKDEKeaRIIDGGDMDKMAGRSDLSVLLGVKLPKIIID 426
109290141 363 YGLSINPYTTRIGQSgeRNVTGDDWDNLVGQSDMSYMLGVKLPRIIPV 410
157311466 364 YSLSVNPYTSKVDQEehQVIKGDDWGKMAGRSEMSYILGIELPPLEID 411
238695046 364 YSLSVNPYTSKVDQEehQVIKGDDWGKMAGRSEMSYILGIELPPLEID 411
304373771 389 YGLSVNPYTTESDSE--RLTKGDDWSNLAGKSKLSQIVGIKLPKLG-- 432
294661609 387 YGLSVNPYTTAANE---RLVKGDDWVNLSGKSKMSQIVGIKLPKLG-- 429
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap