Conserved Protein Domain Family
45

?
PHA02545: 45 
sliding clamp; Provisional
Statistics
?
PSSM-Id: 177380
View PSSM: PHA02545
Aligned: 24 rows
Threshold Bit Score: 276.484
Threshold Setting Gi: 38639944
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161622550   1 MKFSKETLNILKNFSGINPGIMLKPGNTILTRSVTGASYGEATVSDTFDIEAAIYDLNGFLSILSLVSESAEVSVSEDq- 79 
113200662   2 TVISKETIDILQNFSTINKSIVIKPGNQIETLSLNKNILAKAKVQESFDREIPIYDLPSLLAVFNLFDGTPVIDTSQRsw 81 
38639944    1 MQLSKETVEILSNFAKINPSVVLKPGTFVNTKSVNNVLYAESTIKDTVDSELRIYSLGEFLGVAAMVGLPADVTEDGEyi 80 
58532933    4 VILSNQTLQVLKNYSTINSSILIREGNVLKTISVGENAIAQYTCVETFPRTFGIYDLNQFLSGLSLF-ENPTLEFDND-- 80 
66391494    1 MKFSKQTIDILKNFSQINPSIMLTKGSFIMTKSINSVVYAEAEIPDVIDEDVGIYDLNSFLNMMNVVGTDADVKHDLSt- 79 
61806029    1 MKLSEKTLTVLKNFAGINNSILVKEGNQLRTISVAKNILAEANIDEEFPRQFGVYDLNQFLNGLSL-HQDPDLDFTEE-- 77 
61806328    5 TVITKPTIEVLKNFCSINKSIVIKPGNQIATLSINKNILAIADVEEQFDSQISIYDLGVFLGGLSLF-DQPKIDTTAEny 83 
238694910   1 MKLTKETIATLKNFSAINPGIILKKGNVLITKNMTNVVYGEATLNQELEHEIGIYDLNSFLGILNLVGDEADITVDNRt- 79 
255929008   4 VILSKKTLDVLKNFSTINSSIVFRKGSTVRTISNAENILAKFTGEEVFPNDFAIYDLSQFLSGISLFS-DPQLEFDNE-- 80 
294661462   1 MKFSKQTIDILKNFSQINSSIMLTKGSFIMTKSINSVVYAEAEIADVIDEDVGIYDLNSFLNMLNIVGTDAEITHDISt- 79 
161622550  80 TTLIIKDQRSTIKWPIADPSTIAF--PSKAIPFPVAEVIFDLKAEDYQQLMRVSSGLSIDTFAITVDDGKIVINGYKQvD 157
113200662  82 LEVSNPENRSRVKFFYSDPDIIVQp-PEKEVDLPTEDVSFRLEAPVFQQIRKAWSICGVPDLCLYAYNGTLSLCLT---D 157
38639944   81 TIKNAAGGKAMAKIKMAEAGTIAH--PKKALTMPTASVVFEITADQMKQIDKSASTMSLVDLHFVNDGRKIVARL----T 154
58532933   81 NYVTIRGRGRSAKYYFSDPEITLKsaPEKNVRFPGADIEFNLTQEDLLGIQKAAAVYNLPDLVFCSSSEGIFLNLR---D 157
66391494   80 GEIVIRGEKMKIVERSCDPTTIVK--PKKRLQMPVADLIFQISANDFEKLIKASRMMKLTDLSVEPINGKLVIT-----A 152
61806029   78 SYLNIREGKRRVKYFFADPQVIISp-PDKQITLPSEDVHFQLESSALDKLLKAAAVYQLPDLCVVGEAGAVRLVVR---D 153
61806328   84 LTVSDTHGRTKTRFFYADPDIITQp-PEKEIELPSVDVKFNLEAGVLNQLQRAASVYQLPDLCLFSADGVMQLSVT---D 159
238694910  80 GNIRVSNDRLKINYPGASAAAIVS--PKGRVTPPASDVDYELSNDDLKQLMKMSNQLKVDRLEFLPIDGRLMIKGWEE-I 156
255929008  81 SFVNIRGGRQSARYYFSDPEITLKsaPEKNVKFPGADLQFNLTGEDLIALQKASAVYSLPDLTFQSEEGSNEIKLILR-D 159
294661462  80 GEIVIRGDKMKIIERSADATTIPK--PKKRLVMPVADLIFQITANDFEKLIKASRMMKLTDLSVEPIDGKLVIT-----A 152
161622550 158 DKELTRPLYSLVV-ADHDGP--DFKFIINKTNMKMMP---ADYHVLLWARGEgqdarfaAKFEGT--QASYVLAMEAGSS 229
113200662 158 KKNDTSNSYQTEV-GECDEDa-AFCYCFKMENLKLYN---QGYDVTISKHNV-------ARFEAD--NIKYLIALEPNN- 222
38639944  155 GGESNSNSFEIAIaDDFEGDdaTFDFIVAIGNMKMID---GKYTVMIAKEGA-------ICFKGA--TASYIIAIDSKSK 222
58532933  158 KENDTSNDYSQQVvGDSTG---EYELTIKIENIRLLP---GDYSVKVSKALI-------SEWKHNnlDLTYYIALEP--- 221
66391494  153 KSKESQSTFSVEV-GEYEGDn-VFNFDMKIDNMQFIN---SDYKVDLRTGRCkilfrkwRCLRG----CT---------- 213
61806029  154 KKNDTSNSYSVAV-GETDK---EFSFNFKVENIKIIP---GSYDVVVSSKLL-------SEFTNSnyNLKYYIALEPDST 219
61806328  160 KKNDSSNSYSVEV-GESTE---EFCYCFKVENLKLLP---GTYQVSVSKHNV-------ASFKGD--GIKYFIALEPNS- 222
238694910 157 DKNNPNEMFCLDM-GEYTGTa-DFHFFIRKDNMKLVAtdfGDYKLSFTRRKA-------VWLASE--TVSYMIACDLDSS 225
255929008 160 KENDTSNTYDLTVaGCTTG---TYSLDVKIENIRLLP---GDYNVKVSKHLI-------SEWTNQsvDLTYYIALEP--- 223
294661462 153 KSKESQSTFSVEV-GEYEGDn-VFNFDMKIDNMQFIN---SDYKVEISSKGA-------AKFSSDn-GVAYVVVLEASST 219
161622550 230 HS 231
113200662     --    
38639944  223 YT 224
58532933      --    
66391494      --    
61806029  220 FG 221
61806328      --    
238694910 226 YT 227
255929008     --    
294661462 220 FK 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap