Conserved Protein Domain Family
23

?
PHA02541: 23 
major capsid protein; Provisional
Statistics
?
PSSM-Id: 177376
View PSSM: PHA02541
Aligned: 24 rows
Threshold Bit Score: 700.024
Threshold Setting Gi: 255929027
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38640157    1 MSKKSLLKKWQPLVES-EG--MPAIASMKRKDIVARIFENQDEDIAHNEggVYTDQVVVNSMvdvkgrieEARLAEANIG 77 
113200639   1 MSFQNLQEKWAPVLEH-DS--LPEIGDSYKKGVVAQLLENQEKAIAEE----------------------GKILTETL-- 53 
37651642    3 LKNKEILNKWTPLLEG-EG--LPEIAGKNKQALVAQILEAQEKDSKSDP--VYRDDKLIEAF--------GQSLMEAEVA 69 
34419596    1 ---MNLTEKWKDLLEA-EGadMPEIATATKQKIMSKIFENQDRDINNDP--MYRDPQLVEAF--------NAGLNEAVVN 66 
58532919    2 FNAEHLQEKWSPVLNH-GE--APAIGDRYKRAVTSVLLENQERFLREER--GMLNEVAVNSLgagtiapaGSALGSANTG 76 
66391678    2 SKKNELMEKWNDLLESqEG--LPDIATKSKKQLVAAILEAQEKDAETDP--VYRDEKIVESF--------GGFLAEAEIA 69 
66391963    3 LKNKEILNKWTPLLEG-EG--LPEIAGKNKQALVAQILEAQEKDSKSDP--VYRDDKLIEAF--------GQSLMEAEVA 69 
61806310    1 MSIQQLQEKWAPVLNH-ES--VPEIKDSYKKGVVAQLLENQENAIREE----------------------GQVLNETL-- 53 
255929027   2 FNAQALTEKWSPVLGH-EG--AGAIKDNYRKAVTAVLLENTERQLREER----------------------GMINEASTV 56 
294661606   2 SKKNELMEKWNDLLESqEG--LPDIATKSKKQLIAAIMEAQEKDAEVDP--VYRDEKIVESF--------GGFLAEAEIA 69 
38640157   78 GDHGYDATKIASGE----TSGSITNVGPAVMGLVRRAIPQLIAFDICGVQPMTSSTGQVFTLRAIYG--GNSQDANA--- 148
113200639  54 QTTGYTGGDT--------VTGPVAGFDPVLISLIRRSMPQLIAYDIAGVQPMTGPTGLIFAMRTNYGaeRNPAAAGY--- 122
37651642   70 GDHGYDPTNIAAGQ----SSGAITNIGPAVIGMVRRAIPSLIAFDIAGVQPMTGPTGQVFALRSVYG--KDPLAAGA--- 140
34419596   67 GDHGYDPANIAQGV----TTGAVTNIGPTVMGMVRRAIPQLIAFDIAGVQPMTGPTSQVFTLRSVYG--KDPLTG----- 135
58532919   77 GLAGFD---------------------PVLISLVRRAMPNLMAYDVCGVQPMSGPTGLIFAMRSRYE--NQAGEEAL--- 130
66391678   70 GDHNYDQTNIASGK----SSGAITNIGPAVIGMVRRAIPNLIAFDICGVQPMTGPTGQVFALRAVYG--KDPLAGGTpad 143
66391963   70 GDHGYDPTNIAAGQ----SSGAITNIGPAVIGMVRRAIPSLIAFDIAGVQPMTGPTGQVFALRSVYG--KDPLAAGA--- 140
61806310   54 QTTGYTTGDT--------ATGPVAGFDPVLISLIRRSMPQLIAYDVAGVQPMTGPTGLIFAMRSFYGseRRPANSDF--- 122
255929027  57 GAISATGGQALGGSgldtKTGGLAGFDPVMISLIRRAAPNLVAYDICGVQPMSGPTGLIFAMKSHYN--NRSGAEAL--- 131
294661606  70 GDHGYDATKIASGN----SSGAITNIGPAVIGMVRRAIPNLIAFDICGVQPMTGPTGQVFALRAVYG--KDPLASGA--- 140
38640157  149 -REAFHPTYGPDADFSGRGAAQD--------IAVFVRGT---------AVASGAFAKLHIEaatgvQAGTKTVQFIKDYA 210
113200639 123 -DEAF--FNEPNAGFSGGPGAYD-------------------------PGATG--------------------------- 147
37651642  141 -KEAFHPMYAPDAWHSSLATKGAttttdgtpFAKLTAGQ---------AIAEGDIVGHFFY-----ESGTAFLQNVSGAS 205
34419596  136 -AEAFHPTRQADASFSGQAAASTia-----dFPTTGAATdgtpykaevTTSGGDVSMRYFL-----ALGAVTLAVAGQMT 204
58532919  131 -------FNEPDTGFTG---------------------------------------------------GYDASQGDYAVR 152
66391678  144 vREAFHPMFAPDTMYSGEGAHTA--------FAKITTGT---------AIATGAIVYHIFQ-----ETGIAYFQNVTSGN 201
66391963  141 -KEAFHPMYAPDAWHSSLATKGAttttdgtpFAKLTAGQ---------AIAEGDIVGHFFY-----ESGTAFLQNVSGAS 205
61806310  123 -REAL--FNEPNAGFSGGAGTGLs------nYDPTASSS----------------------------------------- 152
255929027 132 -------YNEPDANFSGNQ-----------------------------------------------QGPAAYNDPVAPLG 157
294661606 141 -KEAFHPMFSPDSMYSGQGAAPSn------gFTKLTSAQ---------AIADGAIVFHDFV-----ETGRVFLQNVSGAP 199
38640157  211 VDA-LPADQTEAGLAYKWLLANGYAVETSSAMATAFAELQQGFNGSADNEWNEMSFRIDKQVVEAKSRQLKAQYSIEMAQ 289
113200639 148 ----VTNDAEGTNPALLNDSPAGTYEQADDATGMSTATVEALDDSTANTAFREMGFSIEKVTVTARARALKAEYSIEMAQ 223
37651642  206 VTVgTNETGEALDKLINAAIGEGKLAEIAEGMATSIAELRQGFNGSNDNPWNEMSFRIDKQTVEAKSRQLKAQYSIELAQ 285
34419596  205 ATE------------YTDGVAGGLLVEIDAGMATSQAELQENFNGSSNNEWNEMSFRIDKQVVEAKSRQLKAQYSIELAQ 272
58532919  153 TGAgVGGDSEGNNPALLNDAAPGTYEV-----GSKMPREDLERMGEANRLFREMSFSIEKTSVTAQSRALKAEYTLELAQ 227
66391678  202 VTV-TGADPAALDAAVIAENEKGTLAEISVGMATSVAELQENFNGSSANPWNEMAFRIDKQVIEARSRQLKAQYSVELAQ 280
66391963  206 VTVgTNETGEALDKLINAAIGEGKLAEIAEGMATSIAELRQGFNGSNDNPWNEMSFRIDKQTVEAKSRQLKAQYSIELAQ 285
61806310  153 ----AVNDAEGANPGLLNDSPAGTYEVTGDATGMATATAEALDDSSASTAFREMGFSIEKVTVTAKSRALKAEYSIEMAQ 228
255929027 158 DGGtTDANPGLLNDSGTYERQAGNIPR----------EDAETLGSGAGNLFNEMDFSIEKTAVTAKTRALRAEYTLELAQ 227
294661606 200 VTV-TGSTDDALDAAVIAEQEKGTLAEISYGMATSVAELQEQFNGSTGNPWNEMGFRIDKQVIEARSRQLKAQYSVELAQ 278
38640157  290 DLRAVHGLDADSELSSILANEIMHEINREMVLWINATAKVGKTGWTNMHGGKAGVFDFQDTKDIRGARWAGESYKALVVQ 369
113200639 224 DLKAIHGLDAEQELANILSTEILAEINREVVRTIYTNAVAGAQNNT----ATAGVFDLDVDSNGR---WSVEKFKGLLFQ 296
37651642  286 DLRAVHGMDADSELNGILANEVMLEINREVIDWINYTAQVGKSGWTKTDGSASGVFDFQDPIDVRGARWAGESYKALLIQ 365
34419596  273 DLRAVHGLDADAELSGILANEVMVELNREIVNLVNSQAQIGKSGWTQGAGA-AGVFDFSDAVDVKGARWAGEAYKALLIQ 351
58532919  228 DLKAIHGLDAEQELANILSSEVLAEINREVVRRVYTVAKKGAQNNV----ANAGIFDLDVDSNGR---WSVEKFKGLLFQ 300
66391678  281 DLRAVHGMDADAELSAILATEIMLEINREIVDLINYTAQVGKSGFTQTVGSKAGSFDFQDPVDIRGARWAGESYKALLIQ 360
66391963  286 DLRAVHGMDADSELNGILANEVMLEINREVIDWINYTAQVGKSGWTKTDGSASGVFDFQDPIDVRGARWAGESYKALLIQ 365
61806310  229 DLKAIHGLDAESELANILSTEILAEINREVVRTIYVNAVKGAIANT----ATDGIFDLDVDSNGR---WSVEKFKGLLFQ 301
255929027 228 DLKAIHGLDAEQELANLLSSEILAEINREVVRTVYTVAKPGAQNNV----ANAGIFDLDVDSNGR---WSVEKFKGLMFQ 300
294661606 279 DLRAVHGMDADAELSAILATEIMLEINREIVDMINYTAQVGKTGFTQTVGSKAGAFDFQDPIDVRGARWAGESYKALLIQ 358
38640157  370 IDKEANEIARQTGRGQGNFIICSRNVAAALGHTDMLMTPAVMGANTT---MNTDTTSSLFAGVLAGKYRVYIDQYAVE-- 444
113200639 297 IERDANAIGHQTRRGKGNILICSADVVSALGMAGVLDYTPALNGNNGl--AGVDDTSSTLVGTLNGRIKVYVDPYSANva 374
37651642  366 IDKEANEIARQTGRGAGNFIIASRNVVSALALIDTNISPAAQGMASG---LNADTTKGVFAGILGGRYKVYIDQYARQ-- 440
34419596  352 IEKEANEIGRQTGRGNGNFIIASRNVVSALSMTDTLVGPAAQGMQDGs--MNTDTNQTVFAGVLGGRFKVYIDQYAVN-- 427
58532919  301 VERDANAIAQETRRGKGNFLICSADVASALAMAGVLDYSSGLNGAGGpsiGEVDDTGNLAVGTINGRIKVFVDPYAANls 380
66391678  361 IDKEANEIARQTGRGAGNFIIASRNVVSALARIDSGITPASQGLQKT---LNVDTTKAVFAGVLGGTYKVYIDQYARQ-- 435
66391963  366 IDKEANEIARQTGRGAGNFIIASRNVVSALALIDTNISPAAQGMASG---LNADTTKGVFAGILGGRYKVYIDQYARQ-- 440
61806310  302 IERDSNAIGQETRRGKGNILICSADVASALGMA--GVLDYAPGLQGNsalTGVDDTSSTLVGTLNGRIKVYVDPYSSNva 379
255929027 301 IERDANAIAQQTRRGKGNFIITSADVASALAMSGTLDYSSGLSGAGGpsiGEVDDTGNLLVGTMNGRIKVYVDPYSANvs 380
294661606 359 IDKEANEIARQTGRGAGNFIIASRNVVSALARIDSGITPAGQGLQKT---LNVDTTKAVFAGVLGGVYKVYIDQYARG-- 433
38640157  445 --DYFTVGYKGASEMDAGLYYCPYVALTPLRGTDPKNFQPVLGFKTRYGVKLHPMADATQNKGFAKISNGMPQHtNMFGK 522
113200639 375 dkHFYVAGYKGTSPYDAGLFYCPYVPLQQVRAINPDTFQPKIGFKTRYGMVSNPFAGGLTQGSGA----------LTVNA 444
37651642  441 --DYFTMGYRGANNLDAGIYYCPYVALTPLRGSDPKNFQPVMGFKTRYAIGVNPFAESRTQAPQGRITSGMPGV-NSVGK 517
34419596  428 --DYFTVGFKGSTEMDAGVFYSPYVPLTPLRGSDSKNFQPVIGFKTRYGVQVNPFADPT--ASATKVGNGAPVA-ASMGK 502
58532919  381 dkHYYVIGYKGTSPYDAGLFYCPYVPLQMVRSIDPNTFQPKIGFKTRYGMVSNPFVTTNGLYNGTPDGEAL-----TPNA 455
66391678  436 --DYFTVGFKGDNEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGINPFANSRSQAPADRITSGMISK-EMCGK 512
66391963  441 --DYFTMGYRGANNLDAGIYYCPYVALTPLRGFDPKNFQPVMGFKTRYAIGVNPFAESRTQAPQGRITSGMPGV-NSVGK 517
61806310  380 dkHFYVAGYKGTSPYDAGLFYCPYVPLQQVRAINPNTFQPKIGFKTRYGMVSNPFSGGLTQGSGA----------LTANA 449
255929027 381 nnHYYVVGYKGSSPYDAGLFYCPYVPLQMLRSIDPETFQPKIGFKTRYGMVANPFVEASAGTPDAEA--------LTASK 452
294661606 434 --DYFTVGYKGDNEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGVGINPFANSRSQAPSDRITSGMITK-EMFGK 510
38640157  523 NAFFRRVLVAGV 534
113200639 445 NKYYRRVQVANL 456
37651642  518 NAYFRRVWVKGL 529
34419596  503 NAYFRRVFVKGL 514
58532919  456 NMYYRRVQVTNL 467
66391678  513 NAYFRKVWVKGL 524
66391963  518 NAYFRRVWVKGL 529
61806310  450 NKYYRRVQVANL 461
255929027 453 NQYYRRVLVKNL 464
294661606 511 NAYFRKVYVKGL 522
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap