Conserved Protein Domain Family
N

?
PHA02538: N 
capsid protein; Provisional
Statistics
?
PSSM-Id: 164934
View PSSM: PHA02538
Aligned: 16 rows
Threshold Bit Score: 431.837
Threshold Setting Gi: 9628622
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057357    1 MRPETRFKFNAYLTRVAELNNISTDDVSK--KFTVEPSVTQTLMNTVQASSAFLKTINILPVAEMKGEKIGVGVTGTIAS 78 
17981832    1 ---MNKQAYYALAAALAKHFNQPLDSVLRgeSFALKAPEAALLGENIQQRSDFLKGINMVQVAHTKGTKL-------FGA 70 
17313222    1 MRNETRKQFDAYLAQLAKLNG--VNSAVQ--TFAVEPSVQQKLEQRIQESSEFLKQINVYGVDELQGEKIGIGVSGTIAS 76 
17975128    5 LTQSAREYMDNFAQQLAKSYG--VSNVAE--LFNVSPQLETKLRAAITESAEFLKMITVTTVDQIEGQVVDVGVSGLYTG 80 
9628622     1 ---MNKQAYYALAAALAKHFNQPLDSVLRgeSFALKAPEAALLGENIQQRSDFLKQINMIQVAHTKGQKL-------FGA 70 
72537718    1 MRKETRQAYEKYAAQIAKLND--TGDVSK--KFAVEPTVQQRLETKMQESSEFLKRINVLPVTELEGEKLGLSVSGPIAS 76 
109302917   1 MNKTAQELFYSLIGDAAEYYGANPALALAgkQFSIEAPKESVLLGAIQQRSNFLEKINCVFSERYQ------RAIDLRSN 74 
145708082   1 MRNDTRRLFAAYKAAIAKLNG--VERVDE--KFSVAPSVQQKLETKVQESSDFLKSINFYGVPEQEGEKIGLGVSGPVAS 76 
134288740   1 MRKETRQAYEKYAAQIAKLND--TGDVSK--KFAVEPTVQQRLETKMQESSEFLKRINVLPVTELEGEKLGLSVSGPIAS 76 
134288735   1 MRKETRQAYEKYAAQIAKLND--TGDVSK--KFAVEPTVQQRLETKMQESSEFLKRINVLPVTELEGEKLGLSVSGPIAS 76 
41057357   79 TTDTSGDKERQTADFTALE--SSKYECNQINFDFHLKYKTLDLWARF---QDFQRRIRDAIVKRQALDLIMAGFNGTTRA 153
17981832   71 TEKGVTGRKQTGRNLATLDhsQNGYELSETDSGILVNWSLFDSFAIFk--DRLVELYSEYFQNQVALDILQIGWNGQSVA 148
17313222   77 RTDTTGDGVRKPRDVSALD--NQRYECKHTDFDTAITYAMLDAWAKF---PEFQALLRDAILKRQALDRLMIGFNGTSAA 151
17975128   81 RKAGGRFTKQVGVG-------GHKYKLAETDSCAAITWAMLCQWANQggrDQFMKHLTEFSNQMFALDIMRIGWNGVSAE 153
9628622    71 TEKGVTGRKQTGRNLANLDhtQNGFELAETDSGIIVPWALFDSFAIFk--DRLVELYSEYFQNQVALDILQIGWNGQSVA 148
72537718   77 RTDTT-KAARQPIDPTALD--SNRYRCEKTDYDTAIPYRKLDMWAKF---ADFQQRIRDVILNQGALDRIMIGWNGVKAA 150
109302917  75 RKRHYGAHDRRTPIQQRWTrqVMSMNVSRQIQACLIPWAKLDQWGHLk--DKFASLYAEFVQNQIALDMIKIGFYGTSVG 152
145708082  77 TTDTT-QQDRETSDISTMD--GRRYRCEQTNSDTHITYQKLDAWAKF---ADFQTRIRDAIIKRQALDRIMIGFNGVSRA 150
134288740  77 RTDTT-KAARQPIDPTALD--SNRYRCEKTDYDTAIPYRKLDAWAKF---ADFQQRIRDVILNQGALDRIMIGWNGVKAA 150
134288735  77 RTDTT-KAARQPIDPTALD--SNRYRCEKTDYDTAIPYRKLDMWAKF---ADFQQRIRDVILNQGALDRIMIGWNGVKAA 150
41057357  154 DTSDRTKNTLLQDVAVGWLQKYRNEAPARVMsnitdADGKVVSAVIRV-GKN--GDYENIDALVMDATNNLIDEVYQDDP 230
17981832  149 TNTTKTD---LSDVNKGWLKLLQEQRAANFM-----TESTKSSGKITIfGDN--ADYANLDDLAFDLKQGL-DFRHQNRN 217
17313222  152 ATTNRAANPLLQDVNIGWFQQYRNNAPARVL-----KEGKTTGKVVVGnGAD--ADYKNLDALVFDVVSSLIDPWHRRDP 224
17975128  154 ADTDPSANPLGQDVNEGWIAFVKNRKASQVV-------------DVDVyFDEtnGDYRTLDAMASDIINNQIHPMFRNDP 220
9628622   149 DNTTKAD---LSDVNKGWLKLLQEQRAANFM-----TESTKSSGKITIfGDN--ADYANLDDLAFDLKQGL-DFRHQNRN 217
72537718  151 ATTDRQANPLLQDVNIGWLQQYRERAAQRVL-----HEGAKQAGKVLV-GKA--GDYENLDALVMDIVSSMIDPWFQEDT 222
109302917 153 TDT---SDPNLADVNKGWIQFVRENKATQIL-----TQGA-TSGEIRLfGEG--ADYVNLDELAYDLKQGL-DARHRDAG 220
145708082 151 ATSDRVANPMLQDVNKGWLQNLREQAPQRVM-----KEGKAAAGKITVgGAG--ADYGNLDALVYDITNHLVEPWYAEDP 223
134288740 151 ATTDRQANPLLQDVNIGWLQQYRERAAQRVL-----HEGAKQAGKVLV-GKA--GDYENLDALVMDIVSSMIDPWFQEDT 222
134288735 151 ATTDRQANPLLQDVNIGWLQQYRERAAQRVL-----HEGAKQAGKVLI-GKA--GDYENLDALVMDIVSSMIDPWFQEDT 222
41057357  231 NLVAIVGRKLLADKYFPLVNKQQ-ENSESLAADIIISQKRIGNLPAVRVPYFPANAVLVTTLENLSIYFMDESHRRSIDE 309
17981832  218 DLVFLVGADLVSKETKLIQQKHGlTPTEKAALGSHNLMGSFGGMNAITPPNFPARAAAVTTLKNLSVYTEAESVRRSLRN 297
17313222  225 GLVVILGRELVHDKYFPMVNKDQ-PATEKIATDLILSQKRMGGLPPVEVPYVPEKGLMVTTLKNLSLYWQIGGRRRYLKE 303
17975128  221 RLTVFVGSGLIGAAQAKLYDKAD-KPSEQIAAQKL--DKTIAGRPAYVPPFLPDNAMVVTIPENLQVLTQHGTAQRKAKH 297
9628622   218 DLVFLVGADLVSKETKLIQQKHGlTPTEKAALGSHNLMGSFGGMNAITPPNFPARAAAVTTLKNLSVYTEAESVRRSLRN 297
72537718  223 GLVVICGRELLHDKYFPIVNATQ-APTERLAADLIVSQKRIGNLPAVRVPFFPKRALMVTKLSNLSIYYQEGARRRTLKE 301
109302917 221 DLVFLVGADLVAKEASLVYKGNGlIATEKAALNTHDLMKSFGGMPAMIVPNMPPRAAIVTSLSNLSIYTQEGSMRRGMKD 300
145708082 224 DLVVVCGRNLLSDKYFPLVNRDR-DPVQQIAADLIISQKRIGNLPAIRVPYFPANGLLVTRLDNLSIYYQEGGRRRTILD 302
134288740 223 GLVAICGRELLHDKYFPIVNATQ-APTERLAADLIVSQKRIGNLPAVRVPFFPKRALMVTKLSNLSIYYQEGARRRTLKE 301
134288735 223 GLVVICGRELLHDKYFPIVNATQ-APTERLAADLIVSQKRIGNLPAVRVPFFPKRALMVTKLSNLSIYYQEGARRRTLKE 301
41057357  310 NPKKDRVENYESMNIDYVVEVYAAGCLLENITLGDFTAPAAPE 352
17981832  298 DEDKKGLVTSYYRQEGYVVEDLGLMTAIDHTKVKLNGEV---- 336
17313222  304 VPEKNRIENYESSNDAYVVEDYGLGCLVENIEVAE-------- 338
17975128  298 ESDRKRSKTHTG---AWKVTQWVCWKRSPLTTQKKSTSALNHR 337
9628622   298 DEDKKGLVTSYYRQEGYVVEDLGLMTAIDHTKVKLNGEV---- 336
72537718  302 VPERDRIENYESSNDAYVVEDFGCGCVAENIELAAA------- 337
109302917 301 DDDKKAVRDSYYRNEAYAVEDCGKFMAVDFTKVKLSSGKGTWK 343
145708082 303 NAKRDRIENYESSNDAYVIEDLACAAMAENIALAAAA------ 339
134288740 302 VPERDRIENYESSNDAYVVEDFGCGCVAENIELAAA------- 337
134288735 302 VPERDRIENYESSNDAYVVEDFGCGCVAENIELAAA------- 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap