Conserved Protein Domain Family
43

?
PHA02528: 43 
DNA polymerase; Provisional
Statistics
?
PSSM-Id: 177369
View PSSM: PHA02528
Aligned: 20 rows
Threshold Bit Score: 1319.31
Threshold Setting Gi: 61806054
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
32453540    1 MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQatKYFDIYGKPCTRKLFANMRDASQWIKRMEDI-G 79 
66391489    1 MNEFYLSVEQMGDHIYERFIDADGREQVRKTKYEPTLFQHAMAGTdsPYKDIYGKTCIKKKFDCIKDAKNWMQRMKDV-G 79 
61806348    1 MSKFYTNIQLAGDTILYRGYE-DGERVQFRTHFSPTLYVTSNRKE--KMKTLTGKYVRPIDFQTAREAREFIKTYNGVeK 77 
61806054    1 -MRFYTNVQMVGDNFLVRGYE-DGKHFATREKFYPTLFVDSKKKS--RYKTLTGDPVEAIEPGTVRETREFIKRYDGVeN 76 
38639940    1 --MFYTNVCIQGNTVLERYVDDNGISRSRKVNFGPTLYKHSNNG---ELKDIYGKSATAVDFDSIGDARRWMKDMRDI-N 74 
58532945    1 -MKFYTSVQQAGNFIHVRGYE-NGIQFNDKVQFNPTLFLPTNQPS--RWKTLDGKNVRPVKQGTIRDAKKFVEEHKEIpD 76 
34419317    1 -MTIYTSIERIGSNLCERYIDDDGFEHMRKVKYEPTLFIHCNEET--GYKDIYGRNCRPKMFDTMGEASKYIKETKQF-- 75 
113200680   1 MSSFYTNIQLAGNTILYRGYE-DGQYVQSRTHFSPTLFVSSNKEE--KYKTLDGESVKPIRFESPREAREFIAKYENVeN 77 
157311327   1 --MYFLSCERVGDKIYERYIDDVGQEQERYVEYTPTLFHHAAPGMvtNYKDIYGKPCIAKKFPSMNEANKWRKKMGEM-G 77 
294661455   1 MNEFYLSVEQMGDTIYERFVDSNGTEQVRKTKYAPVMYQHAMNGVetPYKDIYGKPCLKKQFDSIKEAKNWMQRMRDV-G 79 
32453540   80 LEALGMDDFKLAYLSDTYN-YEIKYDHTKIRVANFDIEVTSpDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLlnspyGN 158
66391489   80 MEALGMDDFRLAYISDTYR-NEIEYNRERIRIASLDIEVTA-PEFPDPREAKYAIDAITHYDSVEDKFFVYDLv---eGG 154
61806348   78 FEVHGYERFVYQYIRKEFS-DEVDYHIDQMKIYALDIEVQCeNGFPDVEAAAEEMLSITIKDMVTKKFYIWAV------- 149
61806054   77 FNVYGNERFIYQYISEKYPeEELKFDIDKIKLVTLDIEVKSeQGFPDVESCAEEILLISIQDYNTKQIITW--------- 147
38639940   75 REPLGMDDFVLQYLYHTYS-GPVSFKYEQIDIAFVDIEVPTdGPFPEPHICDWEIDGICHYSTKRKRYSLF--------T 145
58532945   77 FEICGQTRYLNQYISEEYPdDEIKFDSSLIRVFTLDIETAAeNGFPDIETADQEILLISLKDSKTNRITVF--------- 147
34419317   76 NEVLGMDDFIVTYISDVYK--QREFDMSRIRIANIDIETPS-VEFPEAAHAPVPITSIGHYDNIDDKFYVYGI-----PS 147
113200680  78 FRVHGYERYVYQFIAEEFP-GEIDYDMKSMKIFAMDIEVACeNGFPDVASAAEEMLCITIKDLNTKQYYIWAT------- 149
157311327  78 QEALGMDDFIISYLSDTYK-GEIRYDRNKIRVAWVDIEVTA-PEFPKPEEAKYPIDAITHYDSVHDRFFVFDLk---gKS 152
294661455  80 MEALGMDDYRLAYISDMYR-NEIEYNREHIRIASIDIEVTA-PEFPDPREAKYPIDAITHYDSIEDKFYVYDLv---eGG 154
32453540  159 VEEWSIEiaaklqeqgGDEVPSEIIDKIIYMPFDNEKELLMEYLNFW--QQKTPVILTGWNVESFDIPYVYNRIKNIFGE 236
66391489  155 LDEWVASkv-----dtEKEISEEDLKKIVYRAFQTEKSLMSAYIKDW--KERTPVIVTGWNSNKFDIAYIITRYLNIFGQ 227
61806348  150 ---------------------REFETEHEHYIYDSERDMLKGFLEWW--VHNTPDILTGWNVNLYDVPYIARRLNRILGE 206
61806054  148 ----------------GQGPFKNTKKNVLYKSFRTEYELLNDFINWWmiESNTPEVITGWNSKLYDIPYMCRRIDRILGE 211
38639940  146 TRPWDKAksildkddkGNAV--DILDRVDYVFCESERELLIRYLKFF--RDNTPDVFSGWNSEMFDLRYIVNRYRKVLGD 221
58532945  148 ----------------GRYAFDNKHKDVDYMHFGTEVGMLNAFLHFW--TSNYPDVITGWNVQLFDMTYISRRIERVIGE 209
34419317  148 NTEWKRE---------SSIVKPELLEKTVYIRCATEKELLVKYLQFW--REKTPAIVTGWNIESFDMPYIVNRYKNLFGE 216
113200680 150 ----------------REFNPPEGVETNIFW---NEQEMLTSFIQWW--AENTPDILTGWNVNLYDVPYIARRINRILGS 208
157311327 153 GEIWEAS---------KSILRPDIVERVVYNVYDTEDELLLEYIRFF--EENRPVGFTGWNTETFDIPYIIKRISNKFGS 221
294661455 155 LAEWCAAnv------dRKDISEEDLNKIVYRSFQTEKSLLSAYIKDW--KERTPVIVTGWNSDKFDIAYIITRYLNIFGQ 226
32453540  237 STAKRLSPHRKTRVKVI-----ENMYGSREI-ITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKY--DGP 308
66391489  228 NVVRHFSPFGKVTAKTT-----TDQYGNEQLgYEIYGVSQMDGMDLYKKFSFTPQPSYSLGAIAEYETGKNKVDY--EGS 300
61806348  207 KWMRSLSPWNRANEREI------YVQGRKNYaYDVSGINILDYLDLYRKFTYSNQESYRLDHIAFVELGQRKLDHseYEN 280
61806054  212 KLKKRMSPWGLVTEDTT------VIMGREHItYDIGGVSQLDYLDLYKKFTYKAQESYRLDYIASVELGQKKLDHseFDT 285
38639940  222 VYANKLSPWEQIIERTVykdddEGDEAEEIVtYELLGIACLDYMAAYKKFTFKTRPTYKLDYIGQIELGMKKLELt-EKT 300
58532945  210 KEAKLLSPWKSTLAREI------YIKGRKQIaYDISGVATLDYLELYKKFTYTNQESYRLDHIASVELGTKKLDHseYDT 283
34419317  217 KVMNSLSPWGKVQVSTT-----VNDYGQEICkVNILGVSELDYLQLYKKFTYVTRPSYRLDYIGEVELDEKKVEFe-QAN 290
113200680 209 KWMNSLSPWNRANEREI------TIMGRTHIaYDLSGINILDYLDLYKKFTYTNQESYRLDHIAHVELGQRKLDHseYEN 282
157311327 222 RTANRLSPCGKIKSRIS-----QDDFGNEREaFTIMGIESLDYIDLYKKFSFTTQPTYALDYVAEYETGIGKVDY--DGP 294
294661455 227 NVVRHFSPFGKVTARTT-----TDAYGNEQLgYDISGVAQMDGMALYKKFSFTPQPSYRLDAIAEYETGKNKVEY--EGS 299
32453540  309 ISKLRESNHQRYISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVI-PQGRSHP 387
66391489  301 LSELRQKDHQTYITYNIVDVIRVLDIDGKRNFIELVLSVAYYAKINFPGVMSPLKTWDAIIYNSLREDKIAI-PENKRHT 379
61806348  281 FRDFYTRDWQKFIEYNIQDVELIDRLEDKMKLLELAITMSYDAKVNFEDVYSQVRMWDTMIFNYLADKNIVPpPRKGAKK 360
61806054  286 FKDFYTNGWQKFVEYNIIDVELVDRLESKMKLIELALTMAYEAKVNYEDVFYQVRMWDTIIYNYLKRRNIVIpPKNRSDK 365
38639940  301 YLAFSQKNPQKYIDYLIRDVDLLVKLDARLSLMALITSVSYYAKINYNNTFSPLKTWDAIIHNSLIVQGIVV-PENKRTS 379
58532945  284 FKEFYTKDWQKFVEYNIIDVRLVDQLDDKMKLLELAFTMAYDAKVNYEDVFSQVRMWDNYIYIELLKNKIAIpPKKEARK 363
34419317  291 YLEFYEQDYQNFIDYQIQDVNLVKRLDEKLQLMLLTISLAYYAGINYQTVLGTIKPWDAIIFNSLKAEKKVV-PMMRSHE 369
113200680 283 FKDFYTSDWQKFVEYNIQDVELIDRLEDKMKLIELAVTMAYDAKVNLEDVYSQVRMWDTMIYNYLKDRDIVVpPRKGARK 362
157311327 295 LKKLRDDNHQLYIDYNIGDVDRVLAIDKKRGFIDLVYSLCFYAKIKFNHVYNPMKVWDAIIFGSLKAEGKVV-PENKIQP 373
294661455 300 LSELRQRDHQLYITYNIVDVIRVLDIDGKRNFIELVLSVAYYAKINFPGVMSPLKTWDAIIYNSLREDKVVI-PENRRHT 378
32453540  388 VQPYPGAFVKEPIPNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFK-----VAPLH------------DYINAVAERP 450
66391489  380 KTPYDGAYVKDPVVAPYKYIVSFDLTSLYPSIIRQVNISPETIANSFA-----VRPLD------------EYINKTAPRP 442
61806348  361 DEKYAGAYVKEPVPGKYDWVVSFDLNSLYPHLIMQYNISPETLWETRHp----SANVE------------KLLNQEVDLS 424
61806054  366 NDKYAGAYVKEPIPGKYDWVVSFDLNSLYPHLIMQYNISPETIRETRHp----SASVE------------RILNKDCEFD 429
38639940  380 KVKYAGAFVKDPVTAFYRWILSFDLTSLYPHLIMGWNISPETIIDCYD-----VPRVFvkdrmvpdivgmGLVDKQFQVP 454
58532945  364 DAKYAGAYVKEPKPGFYDWVVSFDLNSLYPHLIMQYNLSPETLLSHRHp----TANVD------------RLLNKELDLS 427
34419317  370 GGRFMGAFVKAPQVGYHRGIGSFDLTSLYPSIIRECNISPETIVGQLDyegslEDRID------------KIVEGLITFP 437
113200680 363 DEKYAGAYVKEPTPGLYDWVVSFDLNSLYPHLIMQYNISPETLLDSRHp----SATVD------------RILTESL-EI 425
157311327 374 KQTYPGAFVKEPVPNAYRWMMSFDLTSLYPSIIRQVNISPETIAGSFD-----AAPMH------------AYINKTAPRP 436
294661455 379 KTPYPGAFVKDPVPGPYKYMVSFDLTSLYPSIIRQVNISPETIMGSFA-----VRALE------------EYINKTAPRP 441
32453540  451 S-DVYSCSPNGMMYYKDRDGVVPTEITKVFNQRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPL--DVDYR-------F 520
66391489  443 S-DEFSCSPNGWMFRRDIKGVIPVEIKKVFDQRKMWKKRMMAGERNLELIKHELEHLTDAHNQMIdpDFDFY-------S 514
61806348  425 --GDFAVCANGAQYRKDIKGFLPEMMEKIYTERVIYKKRMIQAKKDYEKEPTK--------------------------- 475
61806054  430 --GDYAVCANGAQYRKDVRGFLPELMDKMYGDRVIFKKKMLQAKQQYEKTPTE--------------------------- 480
38639940  455 N-DDLSFAANGMRYTRKKRGIIPTEIEKVFLQRKAAKNAEFTADKIATIAWDTIVDRKDNNIADTdiDFDAHgidlsikG 533
58532945  428 NlDGQSLAANGTFYDNSKQGFLPKMMQKMYDERVVYKNKMLAAKQKYEENPTI--------------------------- 480
34419317  438 A-DELSNSANGMQYRKDVRGVIPVEIEKVFFQRKANKKKAFEYEQQAIDIQKQMDEQGET-------------------- 496
113200680 426 D-GKYCVCANGAQYRKDIHGFLPEMMQKIYDERTIYKKRMLAAKQDIENAKTPAETL----------------------- 481
157311327 437 S-DEYSCSPNGWMYRKDIHGIVPIEIKKVFDQRKQYKNMMLACDRNAELCKAILHDENHVYGGTIsySVEVR-------H 508
294661455 442 S-DEFSCSPNGWMFRRDIKGVIPVEIKKVFDQRKMWKKRMMAGERNLELIKHELEHLTDAHNQMVdpDFDFY-------T 513
32453540  521 DFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRKLLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERK 600
66391489  515 DFSDESKAVLKTLTKQMLKAVKKVCEKKIAQANTAQLNRKISINSLYGALGNEHFRYFDIRNASAITMFGQLAIQWIERK 594
61806348  476 -----------------------QLEKDISKFNNIQMARKIQLNSAYGAVGNQYFRYYNLLNAEAITLSGQVSIRWIENK 532
61806054  481 -----------------------ALEKEIARCNNIQMAKKISLNSAYGAIGNQYFRYYKLANAEAITLSGQVSIRWIENK 537
38639940  534 ETFDNFIANLKTFNNESLHGIVDYCRFMEKLENVNQQARKVLINSLYGALGNEHFRYYDVRNAEAITMSGQFAIRWIMRK 613
58532945  481 -----------------------ELKKEIARCNNIQMAKKISLNSAYGAIGNEHFRYFRLEIAEAITLSGQLSIRWIENK 537
34419317  497 ---------------PELRAAYEEAKHQAKIYDVQQMARKILINSLYGALGNEYFRFYDLRNAEAVTAYGQLAIKWVARD 561
113200680 482 -----------------------ALQKDVSKFNNIQMARKIQLNSAYGAIGNQYFRYYNLANAEAITLSGQVSIRWIENK 538
157311327 509 DFDEAFKSMLSELSKDALEKLLEECKDESILCNTNQLSRKVLINSLYGALGNPKFRFYDLRNASAITLFGQLAIQWIERK 588
294661455 514 DFSDESKAVLKTLTKQMLKAVKRVCEKKIAQANTAQLNRKISINSLYGALGNEHFRYFDLRNASAITMFGQLAIQWIERK 593
32453540  601 VNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKV-GESKFR----DTNHWVDFLDKFARERMEPAIDRGFREMCEYMN 675
66391489  595 VNEYLNQLCNTTDYAYVRYCDTDSIYVCMDNVIEKVgGESKFR----DNNHWVDFLDKFSRERMEPIIDKGYRELCEYMN 670
61806348  533 MNQKMNKILKTEDVDYVIASDTDSIYLNLGPLVEGV-YKGRKE----TDEVIVGFIDKVCSMELEPYIESSYEALAKYVN 607
61806054  538 MNAKMNNILKTKEVDYVIASDTDSIYLNLGPLVEAV-YKSREK----TNESVVGFLNKVCQNEFEPFIESSYQELADYVG 612
38639940  614 MNEYMNALCQTKDVDYVVYGDTDSIYLTFEKFVNIMaAKKGIQvgdiETIRWVDFLSKFAKEKCEPYIDQSYRELAEYVQ 693
58532945  538 MNEYLNKLLKTDGEDYVIASDTDSIYLNLGPLVEKI-YSNREK----DDESIVNFLDKVCKMELEKYIESSYKELAIYMN 612
34419317  562 VNIWLNKVCKTTDKDYVIYGDTDSIYVNFDPLLELT-GINKL-----EGDDYTDKFAKVCETVETKVINPSYEALHKYMN 635
113200680 539 INQYLNKLLSTEAEDYVIASDTDSIYLNLGPLVSKF-FANKSG----DKAAIVSILDKICQEKLEPFIESSYQELADYVS 613
157311327 589 INEYLNELCGTTDFAYVRYCDTDSVYVLVNNVIDKVgGEDRFD----DTEKLVDFLDNFGKHRMEPIIDKGYRELCEYMN 664
294661455 594 VNEYLNDLCGTTDHAYVRYCDTDSIYVCMDNVIAKVgGEAKFK----DNNHWVDFLDRFAKERMEPMIDKGYRELCEYMN 669
32453540  676 NKQHLMFMDREAIAGPplgskgigGFWTGKKRYALNVWDMEGTRYAE------PKLKIMGLETQKSSTPKAVQKALKECI 749
66391489  671 NVEHLMFMDREIISGPplgskglgSFWTAKKRYAANVWDSEGTRYEK------PKLKIMGMETQRSSTPTAVKVFLKEAI 744
61806348  608 AYDQKMFMKRETIANK--------GIWTAKKRYILNAWDIEGVRFQE------PKLKVMGIEAVKSSTPGACRDKIKECL 673
61806054  613 AYDQKMVMKRENIADR--------GIWTAKKRYILNVWDSEGVRYDE------PKLKMMGIEAVKSSTPAPCRAMIKDAL 678
38639940  694 CYDHKLFMDREIIADT--------AFWTAKKRYAANVWDSEGKRKLDehgnvvPKLKIMGIETQRSSTPVFAGKSLEKSI 765
58532945  613 AYQQKMQMKRENIANR--------GIWTAKKRYILNVWDSEGVRYKE------PKMKIMGLETARSSTPSYYRDKLYQAF 678
34419317  636 TYERQMFMDREVLART--------GFFIAKKRYALDVQDNEGIR--K------PKLKIMGIETQRSSTPPLCQKGLKEAI 699
113200680 614 AYDQKMKMKRENIADK--------GIWTAKKRYILNVWDSEGVRYAK------PKLKMMGIEAVKSSTPAPCRQKIKDAL 679
157311327 665 NYEHLMFMDREAIAGPplksagigGFWTGKKRYALNVWDMEGTRFAE------PKLKIMGLETQRSSTPKACQKSLKECI 738
294661455 670 NVEHLMFMDREIISGPplgseglgSFWTAKKRYAANVWDSEGTRYEK------PKLKIMGMETQRSSTPTSVKVFLKEAI 743
32453540  750 RRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKY-DVGGFPGPKCPFHIRGILTYNRAIKG---NIDAPQVV 825
66391489  745 RRILQEGEESLHESFKVFEEEYKALDYREIAGVSSANNITKYnDGTGHPIKGTPNHIKGVLFFNRLTRG---IQGITQIM 821
61806348  674 KVIMNNDEEDAQEFIAQFREEFNELPIEDIAFPRGCNGINKWaNQTSIYSKGTPIHVRGALLYNYHNTKqrlTHKYPLIQ 753
61806054  679 KLMMNGTEEEVQTFIEECRTKFRKLPPEDIAFPRTASNVQKYkAHATIYAKGTPIHIRGALLFNHYVNQkklDNKYSPIG 758
38639940  766 KLILTKGEQAMQDYVKEVKAEYPKRDYRDIASVSSANNIEKN-HNNWVPVKGCPGHIKGALAYNKVAEQ----RNLDMIR 840
58532945  679 KIILIKTNDDLIDFIEFVKADTRTQDYVNIAFPRGCNGLDKYkSVHDIYKKGTPIQVRGALLYNYYVRKnklTNKYPIIQ 758
34419317  700 RLILQEGEAKLQEFVKGYEKEFKAAPYQEVSFVSSANNMNKYsDDKGNPGKGCPGHVKGALYYNKLAEE----HGFDKIN 775
113200680 680 NVIMNEDEESAQKFIADFREEFTSLPIEDISFPRGCNNLNKWsNPATVYTKGTPIHVRGALLYNFHVKKnklTHKYPLIQ 759
157311327 739 RRMLQEGEESLQEYYGIFEQEFRKLDYLEVAAVSSANNLQKYsDSNGYPIKGCPYAVKSVLCYNRNARK----FGLDPIR 814
294661455 744 RRILQEGELSLHEHYKKFEEEYKELDYREIAGVSSANNISKYrDGAGYPIKGTPNHIKGVLFFNRFTAG---IDGVTPIM 820
32453540  826 EGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPLEGFTSAAKLDYEKKASLFDMFD 902
66391489  822 EGEKVMVLPLRDKNPWQSDCIAWQSGSRLPNEIESDILKWVDYNGLFEKHVISPLKNITEACKIDYEKRASLNTLFG 898
61806348  754 DGEKIKFIYLKTPNKISENVISFPN--TFPKEF--GLDKQVDYELQFSKSFLEPIKVIMDTIGWKPEKIASLEFLFG 826
61806054  759 NGEKVKFLYLKKPNIIQENVISFIQ--DFPHEL--GLDMYIDYDLQFDKSFVEPLRAILNAIEWSVEKTVNLDSFFS 831
38639940  841 SGEKIQIVMLKEPNHIHSPVLAFPSGDKIPDDFNLDLSKYLDFMGMYQKHYLKPLENICSAIGWETEKVASLSDLFG 917
58532945  759 EGEKIKFIYLRTPNPIQENCISFFS--DIPKEF--NVDKYIDYQTQFEKSFLEPLKNVLECIGWDYEKKVSLLSFF- 830
34419317  776 EGDKIAVVFL-TRNKHGIDRIAYPSGGKLPEAI-SYLIDHVDYNRLYEDKFIKPLSAISEAIKFDYKKTITLESFFG 850
113200680 760 DGEKIKFVYLKTPNRINENVVSFFQ--TFPKEL--GLDKQVDYDLQFEKSFLDPLKVIMDTIGWKPEKVASLEFLFG 832
157311327 815 EGEKVMIVPLKDRNPFGEICFGWLSGTRIPPEIESEVLKWLDWPLLFNKTFVKPLENITTAAKLQYEKVASLTDLFD 891
294661455 821 EGEKVMVLPLRDKNPWQADCIAWQSGNKLPSEIESDILAWVDYPGMFEKHVISPLTNITEVCKIDYEKRASLNDLFG 897
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap