Conserved Protein Domain Family
43A

?
PHA02524: 43A 
DNA polymerase subunit A; Provisional
Statistics
?
PSSM-Id: 164925
View PSSM: PHA02524
Aligned: 3 rows
Threshold Bit Score: 980.254
Threshold Setting Gi: 66391839
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109290023   1 MQHYTNIEVIGNTVFERYVKDGVRLSRKTNYQPTLFHHAAPGVETKHKDIYGRFCVPKKHENIWEAKQWQKRMAEIGQDA 80 
37651517    1 MRHYTNIEIIGNNIMERFVDNGKRQTRKVAYQPTLFQHAAPGVQTKHKDIYGRFCVPKKHENIWEAKQWIKRMEEVGMDA 80 
66391839    1 MRHYTNIEIIGNNIMERFVDNGKRQTRKVAYQPTLFQHAAPGVQTKHKDIYGRFCVPKKHENIWEAKQWIKRMEEVGMDA 80 
109290023  81 MGMDDYCISYISDNYRGVIDFDRDNVIIDVVDIEVTAPEFPDPKFAKYEIDMISHVRLHEGKKTYYIFDLVKDVGHWDPS 160
37651517   81 MGMDDYGISYISDTYRGVIDFDRDDVVIDVVDIEVTAPEFPEPKYAKYEIDMISHVRLHNGKKTYYIFDLVKDVGHWDPK 160
66391839   81 MGMDDYGISYISDTYRGVIDFDRDDVVIDIVDIEVTAPEFPEPKYAKYEIDMISHVRLHNGKKTYYIFDLVKDVGHWDPK 160
109290023 161 KSVLDKYILDNVVYMPFDTEIDLLLNYIQLWKSSTPDLVFGWNSEGFDIPYIITRIINILGESAANQLSPYGKISSKTIT 240
37651517  161 KSVLEKYILDNVVYMPFEDEVDLLLNYIQLWKANTPDLVFGWNSEGFDIPYIITRITNILGEKAANQLSPYGKITSKTIT 240
66391839  161 KSVLEKYILDNVVYMPFEDEVDLLLNYIQLWKANTPDLVFGWNSEGFDIPYIITRITNILGEKAANQLSPYGKITSKTIT 240
109290023 241 NMYGEKTIYRIHGVALMDYMDVFKKFSFTVMPDYKLGNVGYREVKADKLEYDGPINKFRAADHQRYVDYCVRDTDIILLI 320
37651517  241 NLYGEKIIYKIHGIALMDYMDVFKKFSFTPMPDYKLGNVGYREVKADKLDYEGPINKFRKADHQRYVDYCVRDTDIILLI 320
66391839  241 NLYGEKIIYKIHGIALMDYMDVFKKFSFTPMPDYKLGNVGYREVKADKLDYEGPINKFRKADHQRYVDYCVRDTDIILLI 320
109290023 321 DGRRCFIDLILSLCYYAKIRFEDVLGTIKVWDSIIFNSLVEKNVVIPMMKASPKQSFPGAYVKEPVPGAYRYGMSFDLTS 400
37651517  321 DGRRCFIDLILSLSYYAKIRFDDVLGTIKVWDSIIFNSLVESNVVIPAMKASPKQSFPGAYVKEPVPGGYRYGLSFDLTS 400
66391839  321 DGRRCFIDLILSLSYYAKIRFDDVLGTIKVWDSIIFNSLVESNVVIPAMKASPKQSFPGAYVKEPVPGGYRYGLSFDLTS 400
109290023 401 LYPSILRLLNISPEMIAGMFSPARIEDYISGVAPKPSDKFSCAPNGMMYKKGVTGVLPTETEKVFLQRKSEKKMMLAAIR 480
37651517  401 LYPSILRLLNISPEMIAGMFSPARLEDYINKVAPRPSDQFSCAPNGMMYKKGVVGVLPNETEKVFLQRKSEKKMMLAAIR 480
66391839  401 LYPSILRLLNISPEMIAGMFSPARLEDYINKVAPLPSDQFCCAPNGMMYKKGVVGVLPNENEKVFLQRKSEKKMMLAAIR 480
109290023 481 NQEAIKKILASRGIKTDH 498
37651517  481 NQEAIKKILASRGVKLDH 498
66391839  481 NQEAIKKILASRGVKLDH 498
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap