Conserved Protein Domain Family
43B

?
PHA02523: 43B 
DNA polymerase subunit B; Provisional
Statistics
?
PSSM-Id: 164924
View PSSM: PHA02523
Aligned: 3 rows
Threshold Bit Score: 718.799
Threshold Setting Gi: 66391838
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66391838    1 MELELFRDFNEEELTYLNTLSTDELQQMIARCEKEEQKRNTNQLNRKILINSLYGALGNNWFRYFDLRNAEAITTYGQLA 80 
37651516    1 MELELFRDFNEEELTYLNTLSTDELQQMIARCEKEEQKRNTNQLNRKILINSLYGALGNNWFRYFDLRNAEAITTYGQLA 80 
109290021   1 MELELFRDFNDAELEYLNTLSNDELQKVIVSCEKEEQKRNTNQLNRKILINSLYGALGNNFFRFYDLRNAEAITTYGQLA 80 
66391838   81 IRWIERKLNEYINELVKTTGVDYVCYIDTDSVYLNMEAVVNRVGIDKFRDTNHLIDFLDNLGSKKLEPFIDDSYKELEEY 160
37651516   81 IRWIERKLNEYINELVKTTGVDYVCYIDTDSVYLNMEAVVNRVGIDKFRDTNHLIDFLDNLGSKKLEPFIDDSYKELEEY 160
109290021  81 IRWIERKLNEYINNLVKTTNVDYVCYIDTDSVYLNMEAVVNKVGIEKFKDTNHLIDFLDNLGQKRLEPYIDESYKELEKY 160
66391838  161 MNHDHHLLLMDREAIFGAPLGSDGIGGFWTGKKRYALNVYDMEGTRYAEPHLKIMGLETQRSSTPLACQKSLKESIRRLL 240
37651516  161 MNHDHHLLLMDREAIFGAPLGSDGIGGFWTGKKRYALNVYDMEGTRYAEPHLKIMGLETQRSSTPLACQKSLKESIRRLL 240
109290021 161 MNNDHHLLLMDREAIFGAPLGSDGIGGFWTGKKRYALNVYDMEGTRYAEPHLKIMGLETQRSSTPLACQKSLKESIRRLL 240
66391838  241 QEGESSLQDYFKEFKDEFKNIPYQDVAAVSSANNIGKNGDALGFPIKGTPYHVKGVLAYNRIAKTDTAIPMISEGEKVMV 320
37651516  241 QEGESSLQDYFKEFKDEFKNIPYQDVAAVSSANNIGKNGDALGFPIKGTPYHVKGVLAYNRIAKTDTAIPMISEGEKVMV 320
109290021 241 QEGESSLQNYFIQFKNEFKTIDYQEIAAVSSANNIAKNADSAGYPIKGAPYHVKGALAYNRIAKTDQSIPEIVEGEKVMV 320
66391838  321 LPLRDRNPFNEACFAWPSGTPIPPAVEADVLKYLDINKLFDKTFVKPLSSICEATKTDYEFRNNLFDMFDI 391
37651516  321 LPLRDRNPFNEACFAWPSGTPIPPAVEADVLKYLDINKLFDKTFVKPLSSICEATKTDYEFRNNLFDMFDI 391
109290021 321 IPLRDRNPFNEACFAWPSGTQIPPVVEADVLKFMDINKLFDKTFVKPLASICEATKTDYEFRNNLFDMFDI 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap