Conserved Protein Domain Family
W

?
PHA02516: W 
baseplate wedge subunit; Provisional
Statistics
?
PSSM-Id: 134016
View PSSM: PHA02516
Aligned: 11 rows
Threshold Bit Score: 150.619
Threshold Setting Gi: 72537704
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109289955   1 MNRETGEQLEDeVEHIKQSIKDILLTAKGSRVMRRTYGSNLYKLTDKPIAASLIMQLSAACVMALQQWEPRIAITRFKVE 80 
72537704    4 MNAETGRSMSG-LDHLAQSIGRIVSTPLGSCIQRRTFGSELPDLIDAPANGATRIRLYAAIATALMRWEPRLTVTRVQIS 82 
145708094   4 MNNATGRALAD-QPHVVQSVRDILSTPIGSRVMRRDYGSQVPDLIDQPLNPATRLRTMSAAVSALVRWEPRIRIASVRFW 82 
41057368    8 MNRNTGIGISD-SEHISQSMRDILLTPVGSRVMRREYGSLLSALIDMPQNPALRLQIMVACYSAIQKWEPRIRLISISFE 86 
9630343     8 MNRSDGLTVTD-LEHISQSIGDILRTPVGSRVMRRDYGSLLASMIDQPQTPALELQIKVACYMAVLKWEPRVTLSSVTTA 86 
17313236    1 MNAHTGGALAR-LAHIRQSIADILTTRIGTRVMRREYGSQLPELIDAPFNDTTRLQVYAATAMALMRWEPRIRLSRVQIT 79 
134288707   4 MNAETGRSMSG-LDHLAQSIGRIVSTPLGSCIQRRTFGSELPDLIDAPANGATRIRLYAAIATALMRWEPRLTVTRVQIS 82 
27311199    1 MNAQTGVVLSG-VSHLRQSVLNILTTPLGSRVYRREYGSRLFDLIDQPTNEAWAVEVYAATAEALARWEPRIRLKRVQVY 79 
30065719    8 MNRSDGLTVTD-LEHISQSIGDILRTPVGSRVMRRDYGSLLASMIDQPQTPALELQIKVACYMAVLKWEPRVTLSSVTTA 86 
134288768   4 MNAETGRSMSG-LDHLAQSIGRIVSTPLGSCIQRRTFGSELPDLIDAPANGATRIRLYAAIATALMRWEPRLTVTRVQIS 82 
169936033   7 MSRNDGQALAD-TDHLRQSVRDILLTPQGSRIARREYGSLLFALIDQPQNPALRLQIMSAVYVALNRWEPRLTLDSITIN 85 
109289955  81 FAEdNynkLICTLDFTLKHRKisiKGMRFTL 111
72537704   83 AAAaDafaGRQFVDIEGWTDE---QDELVSL 110
145708094  83 IDA-D---GKPVIDIEADRVDgprREAAGTL 109
41057368   87 RGD-T---GEMYVDITGMRTD---TGASVST 110
9630343    87 RSF-D---GRMTVTLTGQHND---TGQPLSL 110
17313236   80 GQNlA---GQVLMEIDATLVD---SNEPHNL 104
134288707  83 AAAaDafaGRQFVDIEGWTDE---QDELVSL 110
27311199   80 RQD-N---GSMLIDLEGEYLV---NGESILL 103
30065719   87 RSF-D---GRMTVTLTGQHND---TGQPLSL 110
134288768  83 AAAaDafaGRQFVDIEGWTDE---QDELVSL 110
169936033  86 GNF-D---GSMVVELTG-HSN---NGAPVSL 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap