Conserved Protein Domain Family
PHA02515

?
PHA02515: PHA02515 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 107197
View PSSM: PHA02515
Aligned: 3 rows
Threshold Bit Score: 788.203
Threshold Setting Gi: 41179370
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41179370   1 MSVQSTDRVAGPYPCNGLTTQFPFDFKVFNTGEVVAILSDADGVESTLTLGTDYTVALNDNQDSNPGGTLTTLATYATGY 80 
45580753   1 MSVQSTDRVAGPYPCNGLTTQFPFDFKVFNTGEVVAILSDADGVESTLTLGTDYTVALNDNQDSNPGGTLTTLATYATGY 80 
45569502   1 MSVQSTDRVAGPYPCNGLTTQFPFDFKVFNTGEVVAILSDADGVESTLTLGTDYTVALNDNQDSNPGGTLTTLATYATGY 80 
41179370  81 KITLTSEVPNTQPETLTNQGGFYPKVIEHALDRLVIQIQQLADKLSRTVQAPISGGLSSSEILEQLAEQLPLVSAVYGHL 160
45580753  81 KITLTSEVPNTQPETLTNQGGFYPKVIEHALDRLVIQIQQLADKLSRTVQAPISGGLSSSEILEQLAEQLPLVSAVYGHL 160
45569502  81 KITLTSEVPNTQPETLTNQGGFYPKVIEHALDRLVIQIQQLADKLSRTVQAPISGGLSSSEILEQLAEQLPLVSAVYGHL 160
41179370 161 ANIDAVATNEADIDTVAASVGAVDTVAGDLGGTWAAGVSYDFGSIAVPPIGNTSPPGGNIVIVANSIGNVDTVAENIGDV 240
45580753 161 ANIDAVATNEADIDTVAASVGAVDTVAGDLGGTWAAGVSYDFGSIAVPPIGNTSPPGGNIVIVANSIGNVDTVAENIGDV 240
45569502 161 ANIDAVATNEADIDTVAASVGAVDTVAGDLGGTWAAGVSYDFGSIAVPPIGNTSPPGGNIVIVANSIGNVDTVAENIGDV 240
41179370 241 STVSTHLSSMLAVANDIDSVVSVAGDLENIDAVADNAANINTVAGANANVNTVASNILDVGTVAGNIDDVQAVAGNAANI 320
45580753 241 STVSTHLSSMLAVANDIDSVVSVAGDLENIDAVADNAANINTVAGANANVNTVASNILDVGTVAGNIDDVQAVAGNAANI 320
45569502 241 STVSTHLSSMLAVANDIDSVVSVAGDLENIDAVADNAANINTVAGANANVNTVASNILDVGTVAGNIDDVQAVAGNAANI 320
41179370 321 NVVADNADNINATAANQANINAAVGNADNINAAVANQANINAVVGNANNINAVAANEGNVNTVVDNLADVQTVAGIAADV 400
45580753 321 NVVADNADNINATAANQANINAAVGNADNINAAVANQANINAVVGNANNINAVAANEGNVNTVVDNLADVQTVAGIAADV 400
45569502 321 NVVADNADNINATAANQANINAAVGNADNINAAVANQANINAVVGNANNINAVAANEGNVNTVVDNLADVQTVAGIAADV 400
41179370 401 STVAENEAAVAALGNDLTGQPMVIDYGDLSPASNPAAPAGVLGAVWANAENIAAVAENIAVIIEAANNLPAILAALSGAL 480
45580753 401 STVAENEAAVAALGNDLTGQPMVIDYGDLSPASNPAAPAGVLGAVWANAENIAAVAENIAVIIEAANNLPAILAALSGAL 480
45569502 401 STVAENEAAVAALGNDLTGQPMVIDYGDLSPASNPAAPAGVLGAVWANAENIAAVAENIAVIIEAANNLPAILAALSGAL 480
41179370 481 VPANNLSDLADPAAARANIGLADLGGIA 508
45580753 481 VPANNLSDLADPAAARANIGLADLGGIA 508
45569502 481 VPANNLSDLADPAAARANIGLADLGGIA 508
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap