Conserved Protein Domain Family
V1

?
PHA02513: V1 
structural protein V1; Reviewed
Statistics
?
PSSM-Id: 177367
View PSSM: PHA02513
Aligned: 6 rows
Threshold Bit Score: 186.969
Threshold Setting Gi: 270281816
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
160688421   1 MWSKLKITHNALKVAKNPYRYFTREQIAEATKIFYQTWDGNIISSARKFVELASKNPRITKGEGSiNIGVLLGLFIFILI 80 
42495085    3 VWSKLNVTTEALKVAKNPYKYFTKEQIAEAIRIFYQVWDGNIISSAKRFVEVASKNPKLTRGEAT-NIGAILGLFIFILI 81 
19263455    4 KIASLKEAKVALKVASDPRKYFNEEQMTEAYRIFWQTWDGDIIRSARRFVEVAKANPKLTKGEAT-NIGVLLGLFIFILI 82 
198449232   3 VWSKLKITHETLRVAKNPHKFFTKDQIEEAIKIFYQTWDGNIVSSARKFVEVASKNPKLTRGEAT-NIGAILGLFIFILI 81 
270281782   6 SMADIIVTLSALKVFKNPTKYFTSEQIEEGVKIFWQTWDGNIIRSAQKFIEVAKANPKLTKGEGSvNVGMLIALFIFILI 85 
270281816  14 GVSKAKVVYYVTHIE----KYFSKEQIAEATKIFYQTWDGNIVSSAKRFVEVAKANPKLAKAEGV-NVGLLIALFIFILI 88 
160688421  81 GIVLLPVITSQVNNLTSGTTPSVTGTNATLLNLVPLFYILVLIIVPAVIAYKIYKD 136
42495085   82 GIVLLPVIVSQVNNLTSGTAPSVTGTNATLLQLVPLFYILVLIIVPAVVAYKIYKD 137
19263455   83 GIVLLPVIVSQVNNLTSGTSPQVTGTNATLLNLVPLFYILVLIIVPAVVAYKIYKD 138
198449232  82 GIVLLPVIVSQVNNLTSGTTPSVTGTNATLLQLVPLFYILVLIIVPAVVAYKIYKD 137
270281782  86 GIVLLPVITSEVSGLTSGTDASVTGTNATLLNLVPLFYILVIIIVPAVVVYKMMK- 140
270281816  89 GIVLLPVITSEVNNLTSGTAPSVTGTNATLLDLVPLFYILVIIIVPAVVVYKMMK- 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap