Conserved Protein Domain Family
PHA02508

?
PHA02508: PHA02508 
putative minor coat protein; Provisional
Statistics
?
PSSM-Id: 107192
View PSSM: PHA02508
Aligned: 2 rows
Threshold Bit Score: 68.4118
Threshold Setting Gi: 118430719
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626320    1 MARLLALVIGYaLSSFVLKLFTVLGVGIFTYVGLTALVDGFLNLLQPMLTGLPSYILDILAIAGVPEALSIVGSALLTRA 80 
118430719  1 MMPLAGFLMAL-VGPLARQLLVSLGIGLITYVGLDAAVSAALGAAKSSLAGMPAVAAAILARGGVFTGLSIIAGGITARI 79 
9626320   81 SINSAKAfVGVLT 93 
118430719 80 SMITLKR-LGKLT 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap