Conserved Protein Domain Family
PHA02503

?
PHA02503: PHA02503 
putative transcription regulator; Provisional
Statistics
?
PSSM-Id: 177365
View PSSM: PHA02503
Aligned: 6 rows
Threshold Bit Score: 83.2681
Threshold Setting Gi: 45597390
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13095816  1 MEQEKTINHLGQVVYQESVEFYKEKLSVHSKDFLQNSLIPQLYEWSNAYKAAVELTK 57 
13786540  2 KNQEKTINHLGQIVYQESVEFYKEKLSVYSKDFLQNSLIPQLYEWSNAYKAAIELTK 58 
21716082  5 MEQVKTINHLGQVVYQESVEFYKEKLSVCSKDFLQNALIPQLYEWSNAYKAAVELTK 61 
45597390  2 KNQEKTINHLGQIVYQESVEFYKEKLSVYSKDFLH-SLIPQLYEWSNAYKAAVELTK 57 
30089867  2 KNQEKTINHLGQVVYQESVEFYKEKLSVYSKDFLKNSLIPQLYEWSNAYKAAVELTK 58 
23455727  2 KNQEKTINHLGQIVYQESVEFYKEKLSVHSKDFLQNALIPQLYEWSNAYKAAVELTK 58 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap