Conserved Protein Domain Family
A

?
PHA02458: A 
protein A*; Reviewed
Statistics
?
PSSM-Id: 164919
View PSSM: PHA02458
Aligned: 5 rows
Threshold Bit Score: 601.894
Threshold Setting Gi: 242346743
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9626374     1 MKSRRGFAIQRLMNAMRQAHADGWFIVFDTLTLADDRLEAFYDNPNALRDYFRDIGRMVLAAEGRKANDSHADCYQYFCV 80 
176120946   1 MKSRRGFTVQRLMNAMRTAHSKGWYVVFDTLTLADDRLKDFYDNPNALRDYFRDIGRMVLTAEGRSVHDSSSDCYQYFCV 80 
89888096    1 MKSRRGFTVQRLMNAMRTAHTDGWYVVFDTLTLADDRIKDFYANPNALRDYFRDIGRMVLTAEGRSVHDSSSDCYQYFCV 80 
89888609    1 MKSRRGFTVQRLMNAMRTAHTEGWYVVFDTLTLADDRLKDFYDNPNALRDYFRDIGRMVLTAEGRSVHDSSSDCYQYFCV 80 
242346743   1 ---------------MRIAHQKGWFFVFDTLTLADDRLQAFNENPNALRDYFRTVGRAVLRAEGRSVKDSYNDCYRYLCV 65 
9626374    81 PEYGTANGRLHFHAVHFMRTLPTGSVDPNFGRRVRNRRQLNSLQNTWPYGYSMPIAVRYTQDAFSRSGWLWPVDAKGEPL 160
176120946  81 PEYGTQHGRLHFHAVHLMRTLPLGSLHPNFGKLVRINRQINSLQNTWPYGYSMPIAVRYSQDAFSRAGWLWPVDSKGEPL 160
89888096   81 PEYGTQHGRLHFHAVHLMRTLPLGSLDPNFGKLVRTNRQINSLQNTWPYGYSMPIAVRYSQDAFSRAGWLWPVDTKGEPL 160
89888609   81 PEYGTQHGRLHFHAVHLMRTLPLGSIDPNFGKLVRTNRQINSLQNTWPYGYSMPIAVRYSQDAFSRAGWLWPVDTKGEPL 160
242346743  66 PEFGGQHGRLHWHVVHMVRTLPLGSHDPNFGRKVRNYRQINSFRGMWPYGFTQPIAVRYQHDAYSRKGWLWPVDKSGKAM 145
9626374   161 KATSYMAVGFYVAKYVNKKSDMDLAAKGLGAKEWNNSLKTKLSLLPKKLFRIRMSRNFGMKMLTMTNLSTECLIQLTKLG 240
176120946 161 KATSYMAVGFYVAKYVNKKSDIDMAVKGLGNKEWNNSLKTKINLIPKKVFRIRMSRNFGMKLLSMAHLSAETLMELTQVG 240
89888096  161 KSTSYMAVGFYVAKYVNKKSDVDIAAKGLGNQKWNATLKTQMALLPKKLFRIRMSRNFGMKLLPMTTLTAECLIQLTQVG 240
89888609  161 KATSYMAVGFYVAKYVNKKSDIDMASKGLGNKEWNNSLKTKINLLPKKIFRIRMSRNFGMKLHTMSHLSAETLIQLTQVG 240
242346743 146 QSKPYQAVAWYVTKYVAKQSDQRQKAITERQKKCKNPL---MAICLKKEFRVRSSRKLGMELPSMAHLSNKVLLELSRIS 222
9626374   241 YDATPFNQILKQNAKREMRLRLGKVTVADVLAAQPVTTNLLKFMRASIKMIGVSNLQSFIASMTQKLTLSDISDESKNYL 320
176120946 241 YDVTPFNNILKQNAKKELKSRLAKKSVADVLEAQPVTTNLLKFMRNLTRTIGASNLQSFIASMTTKLTSTDISDETKNYV 320
89888096  241 YDVTPFNNILKQNAKKELRLRLAKQSVADVLEAQPVTTNLLKFMRNLTRTIGASSLQSFIASMTQKLANTDISDETKNYV 320
89888609  241 YDVTPFNNILKQNAKKELRLRLAKKSVADVLEAQPVTTNLLKFMRNLTRQIGVSNLQSFIASMTTKLTSMDISDETKNYV 320
242346743 223 FDSSPLYQIVKENAKKQLTLNIGALPLHVILDVRPEVRSMLKIIRRLMKKTPEFNWQSSIASMTVTLKNGDISDEARQYI 302
9626374   321 DKAGITTACLRIKSKWTAGGK 341
176120946 321 ASAGIAVANLRIKSKWTAGGK 341
89888096  321 TNAGIAVADLRLKSKWTAGGK 341
89888609  321 DTAGITATHLRIKSKWTAGGK 341
242346743 303 IDAGITPTDLRAKATQAFGGK 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap