Conserved Protein Domain Family
PHA02456

?
PHA02456: PHA02456 
zinc metallopeptidase motif-containing protein
Statistics
?
PSSM-Id: 164918
View PSSM: PHA02456
Aligned: 3 rows
Threshold Bit Score: 244.861
Threshold Setting Gi: 118197659
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157265523   1 MSLDLIKLVLLGWALLTRGAPNEWDVALQARVYWSLGAGGGL-ELAWDPVPIYLRALPQDLCG-QFVGWIEMDPDYANKG 78 
157265406   1 MSLDLIKLVLLGWALLTRGAPNEWDVALQARVYWSLGAGGGL-ELAWDPVPIYHRALPQDLCG-QFVGWIEVDPDYANKG 78 
118197659   1 MYIDVIKLILL-IVSFTNGKPATEDIAWQVAFKFTLPENTPIvEVSFDYVPIYFSSLNGNLCGiSYGAFVIIDPNNKEKG 79 
157265523  79 CRDTLAHELNHAWQFRTYGLVQPITYAISAKVWEPEVPASGAEGMPAPRQLNYPLLKVWVPIW 141
157265406  79 CRDTLAHELNHAWQFRTYGLVQPITYALSAKVWEPEVPASGAEGMPAPRQLNYPLLKVWVPIW 141
118197659  80 CENTLEHELAHIWQYRSYGFILPITYPFMKDFWETDEPWHKIP--ETHRVLNFPLIRFYIPLT 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap