Conserved Protein Domain Family
PHA02451

?
PHA02451: PHA02451 
hypothetical protein
Statistics
?
PSSM-Id: 177364
View PSSM: PHA02451
Aligned: 9 rows
Threshold Bit Score: 76.1154
Threshold Setting Gi: 206599717
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157786538  2 PQTVHVLPVDDLIEHEDiGDDCVCGPEIEPVFDADGACGWVITHHSLDGRERFEC 56 
109522788  1 MMIVHVLPVDDLIEHVE-SPDCPCDPGLELIERTDDHFGQMYSHNAADGRNDEAE 54 
109522579  1 -----MLPVDDLIEHVE-SPDCPCDPGLELIERTDDHFGQMYSHNAADGRNDEAE 49 
192823876  2 PQTVHVLPVDDLIEHEDiGGDCVCGPEIEPVFDADGACGWVITHHSLDGRERFE- 55 
192824148  2 PQTVHVLPVDDLIEHEDiGGDCVCGPEIEPVFDADGACGWVITHHSLDGRERFE- 55 
189043164  1 -----MLPVDDLIEHVE-SPDCPCDPGLELIERTDDHFGQMYSHNAADGRNDEAE 49 
206599717  1 ------MPVDDLIEHVE-SPDCPCDPDLELIERTDDHFGQMYSHNAADGRNDEAE 48 
206599807  1 MMIVHVLPVDDLIEHVE-SPDCPCNPDLELIERTDDHFGQMYSHNAADGRNDEAE 54 
206599631  1 MMIVHVLPVDDLIEHVE-SPDCPCDPDLELIERTDDHFGQMYSHNAADGRNDEAE 54 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap