Conserved Protein Domain Family
PHA02448

?
PHA02448: PHA02448 
hypothetical protein
Statistics
?
PSSM-Id: 107186
View PSSM: PHA02448
Aligned: 7 rows
Threshold Bit Score: 379.016
Threshold Setting Gi: 109522145
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109522145   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80 
109392246   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80 
157311253   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80 
194303016   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80 
206600244   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80 
206599939   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80 
291084914   1 MSEPDVEGLAKLREPFPPNQIGKLPKGGITLDFLGHGYLTARFLDVDPLWTWEPFAVGDNGLPLLDEHGGLWIRLTLCGV 80 
109522145  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
109392246  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
157311253  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
194303016  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
206600244  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
206599939  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
291084914  81 TRIGYGDAGGKKGPNAVKEAIGDALRNAGMRFGAALDLWCKGDPDAPAPPDPAVAERNALLHELGDACAALTLDEKTVAA 160
109522145 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
109392246 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
157311253 161 QFYGKYKVTARNAKPQQLREFIDDLMENGAPA 192
194303016 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
206600244 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
206599939 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
291084914 161 QFYGKYKVTARNAKPAQLREFIDDLMENGAPA 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap