Conserved Protein Domain Family
PHA02446

?
PHA02446: PHA02446 
hypothetical protein
Statistics
?
PSSM-Id: 177363
View PSSM: PHA02446
Aligned: 8 rows
Threshold Bit Score: 319.335
Threshold Setting Gi: 109392240
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157311247   1 MNIDWFAVECASNGTPMRLNTDERRMMVRRRPNLPEVELARRSFCTVRTIERDRADLADAEQQQCPLCGQAAWVIHTGIV 80 
109522139   1 MSIDWFAVECAVNGTPMRLNTEERRMLVRRRPKLPEVELARRAHCTVRTIERDRAELPEAKLQSCPVCGEDAWVTTDGNM 80 
109392240   1 MSIDWFAVECAVNGTPMRLNTEERRMLVRRRPKLPEVELARRAHCTVRTIERDRAELPAAKLQSCPVCGEDAWVTTDGNM 80 
194303010   4 VSIDWFAVECAVNGTPMRLNTEERRMLVRRRPKLPEVELARRAHCTVRTIERDRAELPEAKLQSCPVCGEDAWVTTDGNM 83 
206600239   1 MNIDWFAVECAANGTPMRLNTDERRMMVRRRPNLPEDELARRSFCTVRTIERDRADLADAEQQQCPLCGQTAWVIHTGIV 80 
206600131   1 MSIDWFAVECAVNGTPMRLNTEERRMLVRRRPKLPEVELARRAHCTVRTIERDRAELPAAKLQSCPVCGEDAWVTTDGNM 80 
206599935   1 MNIDWFAVECASNGTPMRLNTDERRMLVRRRPNLPEVELARRSFCTVRTIERDRADLADAEQQQCPLCGQAAWVIHTGIV 80 
291084909   1 MNIDWFAVECASNGTPMRLNTDERRMLVRRRPNLPEVELARRSFCTVRTIERDRADLDDAEQQQCPLCGQAAWVIHTGIV 80 
157311247  81 EAHPDKLLQECPMSgqsvAADWESQTAATVVWLSRRIRVGDSIGVWDYLTKLPEDQRTQLLMAALAGIPDVEDPFAWITe 160
109522139  81 EAHPDRLFQECPLS----ETDWESRIAATVIWLSRRIRSGDSLPVWAYLTSLPETERTQLLMAALAGVPDVEDPFAWIT- 155
109392240  81 EAHPDRLFQECPLS----ETDWESRIAATVIWLSRRIRSGDSLPVWAYLTSLPETERTQLLMAALAGVPDVEDPFAWIT- 155
194303010  84 EAHPDRLFQECPLS----ETDWESRIAATVIWLSRRIRSGDSLPVWAYLTSLPETERTQLLMAALAGVPDVEDPFAWIT- 158
206600239  81 EAHPDKLLQECPLSgqsvAPDWESQTAATVVWLSRRIRVGDSLGVWDYLTKLPVDQRTRLLMAALAGIPDVDDPFAWITe 160
206600131  81 EAHPDRLFQECPLS----ETDWESRIAATVIWLSRRIRSGDSLPVWAYLTSLPETERTQLLMAALAGVPDVEDPFAWIT- 155
206599935  81 EAHPDKLLQECPMSgqsvAADWESQTAATVVWLSRRIRVGDSIGVWDYLTKLPEDQRTQLLMAALAGIPDVEDPFAWITe 160
291084909  81 EAHPDKLLQECPMSgqsvAADWESQTAATVVWLSRRIRVGDSIGVWDYLTKLPEDQRTQLLMAALAGIPDVEDPFAWITe 160
157311247 161 EVEQVA 166
109522139 156 ELESVA 161
109392240 156 ELESVA 161
194303010 159 ELESVA 164
206600239 161 EVEQVA 166
206600131 156 ELESVA 161
206599935 161 EVEQVA 166
291084909 161 EVEQVA 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap